KEGG   Vibrio cholerae O1 M66-2: VCM66_A1061Help
Entry
VCM66_A1061       CDS       T00891                                 

Definition
(GenBank) sensor histidine kinase
  KO
K07645  two-component system, OmpR family, sensor histidine kinase QseC [EC:2.7.13.3]
Organism
vcm  Vibrio cholerae O1 M66-2
Pathway
vcm02020  Two-component system
vcm02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:vcm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VCM66_A1061
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    VCM66_A1061
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vcm01001]
    VCM66_A1061
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vcm02022]
    VCM66_A1061
Enzymes [BR:vcm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     VCM66_A1061
Protein kinases [BR:vcm01001]
 Histidine kinases
  OmpR family
   VCM66_A1061
Two-component system [BR:vcm02022]
 OmpR family
  QseC-QseB (quorum sensing)
   VCM66_A1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA 2CSK_N HATPase_c_5 HATPase_c_2 Phage_Gp111
Motif
Other DBs
NCBI-ProteinID: ACP08020
UniProt: C3LX15
Position
II:complement(1034171..1035586)
Genome map
AA seq 471 aa AA seqDB search
MKNKPLFSIKRRLTLTSVLLSTGLMLVSFGFSYSNAQHEVGEVYDARLGQSAKLLLIATS
VSANEFADRNQHEQFNLWMQHIQRLSKANDDVATLFGHPYEQYLLFQFYREGDLLFSSDT
HLPALSLGRDANGFSDITLNGESWRYFQLSLPDQEKGKQYVLVAEKQSIRDEAINEIALS
TALPQLILILCLIVVLVVLIERSFQPIQALKAAIALRSIHKLDRIYVEKPTVELLPLVET
LNQLLNELEQAWQREKRFTRMAAHELKTPLTVLRVNAENALRSTNQEQLKQDLERIFKGI
ERTDRLIHQLLMLAKVESTQTLRKQPVELANVIKQVIADLAPIAFKQDQQLSFHGESSRL
WGDELLLGILFKNLLDNAIRYSGHSSQIAVELSDHDGEIEVRVSDTGAAIDDLTREKMFD
NFYRANSQKGDGAGLGMSICRDIAALHGGQVLLLPRTDERNTFVVRFRNCE
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaataaacctctcttttccattaaacgccgacttaccctgacttctgttttgctg
agtaccggtttgatgctggtctcgtttgggttcagttattccaacgcccaacatgaagtg
ggagaagtgtacgatgcccgtcttgggcagtccgccaaattattactgatcgccacttct
gtttcggccaatgaatttgcagatcgtaatcagcatgagcagttcaatctgtggatgcag
catattcagcgcctttccaaagccaacgatgatgtcgccacgctctttggccacccgtat
gaacagtatttattattccagttttatcgagagggcgatcttctctttagctctgatact
catttgcctgcgctgagtcttggccgtgatgcgaatggttttagtgatatcacgctcaac
ggcgaaagctggcgttatttccagttgagtctccctgatcaagaaaagggtaaacagtat
gttttggttgcagaaaagcaaagcattcgtgatgaagcgattaatgagatcgccttatcc
accgcacttccgcaattaattttaattctgtgcttgattgtggttttggtggtgctgatt
gaacgtagctttcagccaatccaagcgctgaaagcagcgattgctctgcgcagcatccat
aagctagatcgaatttatgtcgaaaaacctacggtggaacttttgcctttggtggagacg
ttgaatcaactgctcaatgagctagagcaagcatggcagcgtgagaaacgttttactcga
atggcggcacatgagttaaaaaccccgctgaccgttttaagagtgaatgccgaaaatgcc
ctgcgtagcaccaatcaggaacagttaaagcaagatttagaacgtattttcaaaggtata
gagcgcaccgatagattgattcatcagctcttaatgctggccaaagtagaaagtacacaa
accttaaggaaacagccggttgagctggcaaacgtcattaaacaagtgatagcggattta
gcacctatcgcttttaagcaggatcagcagctgagttttcatggcgaaagttcgcgttta
tggggagatgagttactcctgggcattttatttaaaaatctgctggataatgccattcgt
tattccggccactctagccagatagcggtagagcttagcgaccacgatggtgagattgaa
gtgcgtgtgtcggatactggggccgcgattgacgatctgactcgtgaaaaaatgtttgat
aacttctaccgtgccaacagccaaaaaggcgatggcgcagggcttggcatgtcgatctgt
cgtgatattgcagcgcttcatggcggtcaagtgctcttgctgccacgtactgatgagcgt
aatacctttgttgttcgttttcgcaattgcgaataa

DBGET integrated database retrieval system