KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_103465Help
Entry
VOLCADRAFT_103465 CDS       T01330                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00260  Glycine, serine and threonine metabolism
vcn00750  Vitamin B6 metabolism
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
vcn01230  Biosynthesis of amino acids
Module
vcn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VOLCADRAFT_103465
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    VOLCADRAFT_103465
Enzymes [BR:vcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     VOLCADRAFT_103465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 9620481
NCBI-ProteinID: XP_002947518
JGI: 103465
UniProt: D8TM26
Position
Unknown
AA seq 505 aa AA seqDB search
MRTLQQPTLRSGARRGVFTPCSRNMQRILATAAHADIRREAMLRVPLEKAHTFNAKFVPF
TDIQTSNTSSEFYSLDDVVYRSRDGGLLDVHHDMKALSQYGPEYWRALFDARVGTTAWPF
GSGVWSKKEWVLPGLSDDDIVSMFEGNSNLFWAERFGKEALGMTDLWVKQCGNSHTGSFK
DLGMTVLVSQVNRIRKLKPGSITAVGCASTGDTSAALSAYCAAAGIPSIVFLPADKISLA
QLVQPIANGALVLSIDTDFDGCMRLIKQVTAETPIYLANSMNSLRLEGQKTAAIEILQQF
DWQVPDWVIIPGGNLGNIYAFYKGFKMCKELGLVDKMPRLVCAQAQNANPLYQAFHKAQG
VSQIKESYQAVKAKTTFASAIQIGDPVSIDRAIMALQDANGIVEEASEEELMDAAARADR
TGMFNCPHTGVALAALLKLRERQIIGPNDRTVVVSTAHGLKFAQSKVAYHSKSVPNMTCQ
FANPPVQVKEDLGAVMDAIKAKFSL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaggacacttcagcagccaacccttcgcagcggcgcgcgcaggggtgtgttcacacca
tgcagccgtaatatgcaacgaattctcgccacagctgcgcacgcggatatccgacgggaa
gctatgctccgggtgccgcttgagaaggcgcacacgttcaatgccaaattcgtgcctttc
accgatatccaaactagcaatacgtctagcgaattttacagtctggacgacgtcgtttac
cgatcgcgggacggcggcctgctggatgtgcaccatgatatgaaggcgttgtcgcagtat
ggaccggagtactggcgagccttgtttgatgctcgggttgggacaactgcttggcccttc
ggatccggtgtatggagcaagaaggaatgggtgctgccgggtctgtcggacgatgacatt
gtgtctatgttcgaaggcaacagcaacctattctgggcggaacgttttggcaaggaggcc
ctgggtatgactgacttgtgggtcaagcagtgcggtaacagccatacgggctccttcaag
gatttgggcatgacagtgcttgttagtcaggtgaaccgcattcggaagcttaagccaggc
agcatcacagccgttggctgcgcttccactggcgacacgtcagcggcgctgtctgcctac
tgtgccgccgcgggcattccctcgatcgtcttcctgccagcggacaaaatctcgctggcg
cagctcgtgcaaccaattgctaatggcgcgctggtgcttagcattgacacggactttgac
ggctgcatgcgcctgatcaagcaggtcacggcagagacccccatctacctggcgaacagc
atgaacagcctgcggcttgaggggcaaaagaccgctgcaattgagattttgcaacagttc
gactggcaagtgcccgactgggttattatccccggtggcaacctcggcaatatctatgcc
ttttacaagggcttcaaaatgtgcaaggagctgggtctcgtggacaagatgccgcggctc
gtgtgcgcacaggcacagaacgccaacccgctttaccaggcgttccataaagcgcaaggt
gtttcgcaaattaaggagagctaccaggccgtcaaggcgaagactaccttcgcttcggcc
atccagatcggcgatcctgtgtccatcgaccgagcaatcatggcgctgcaggacgccaac
ggcattgtggaggaggcctcggaggaggagctcatggacgccgcggcgcgtgcggaccgc
accggcatgttcaactgcccccacacgggtgttgcgctcgccgcattactcaagctccgg
gaaaggcagattattgggcctaacgacaggacggtagttgtcagcacagcccatgggctc
aagttcgcgcagtcaaaggtggcctaccactccaaatccgttcccaacatgacgtgtcag
ttcgcgaacccgccggtgcaggttaaggaggacctgggtgcggtgatggacgcgatcaag
gctaagttcagcctctga

DBGET integrated database retrieval system