KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_104207Help
Entry
VOLCADRAFT_104207 CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00010  Glycolysis / Gluconeogenesis
vcn00562  Inositol phosphate metabolism
vcn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VOLCADRAFT_104207
   00562 Inositol phosphate metabolism
    VOLCADRAFT_104207
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     VOLCADRAFT_104207
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     VOLCADRAFT_104207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase His_Phos_2 Pkinase_Tyr
Motif
Other DBs
NCBI-GeneID: 9623841
NCBI-ProteinID: XP_002949136
JGI: 104207
UniProt: D8TS44
Position
Unknown
AA seq 1507 aa AA seqDB search
MGPISAAPLLILTVVCLSSLAARGFDVRRHLGTKTRYAFRLAVSSSPSVYKAPDPEGYDP
VHLYLLARHGTRWPTGDRMRQINSLEALFADARNTADHPWIRNWTAPFSNVALMGGELHP
TGADELWNLAYRLRKRFPSLSSQDYLPKRFPVVSTQVARTAASASAFTSGFFPGVGTKDL
ADDSRDVNPEPPRAPADANAVRSGGEVMNSDPAGQPRRVALQGGRLKSPLVAAAALHEEL
DETLRDSPKIRRPQAVAISMAPKDADPLLRFFEVCPAYAQHDEFTEKWIGPWMQGNWSRL
VPILEQRLDLPRDMSPCEVEALWQLCLLEAGLYDITNQACSLFEPEEVMMLEWVDDIHLL
ETQSYGATINYEIAAPLLHDATEALKAAAAAAHTPDGAMAPVARFLFAHCETLVPLASLL
GLFRPPVPPPPGATSAQLAASVSPAAAQRHLRRLDTLEDLHMMATGLQHLNAIGRRGPGS
GSPGSGGGGGRSPGSMASEDSHVCYKGRPPPPTDWVEPPEGWYPMFTCDDYRMFKGARIA
PFGANMALVLYRRREGDGAPRGRPKHLVRLLYNEQVLPVPGCSSAASGRGGEGSDESLDC
DLEEFLQLVKDKTDPNALERLCGSEGEENLARRVERDLAQQTTLATLDLRPKCRNGEQQQ
EFGQPQRLASDTGSSCPHCSAASNSDALAGVPRGLCQGSARGPRQGKGTQPSAVATTAAP
AVDIHLPSCAHPTSAGDGRAAAGVAGAVPAVAEALTAHAFSRLAEAAAPGPSPDGVLSPV
SPPSSRRSSLSNLAALPGTQDVTLHNGVGLACKSSSDVEAAPCAAAAAAATAATSSAPVR
SGSSTSLSTGSSHDQREQQAFPQAPAQGKGLRVEPAATVAGAAGGEWLLADQRAADNAGE
PRLQLPAQDVGLCSMGLQLPHRRPATLRLRCIVRDPVTGSMLATARGHVDDASLPLCRPR
ARHMAAAAAGEGTCAQPGHLLFVEEAVLGRGAFGFVTLVTVLCSSPGSTHAVTERSYALK
RLRRSAISPKHVMQEQQALRLLMTEQQLAASRAAAEVADGGQQQQQEKENLPRGRGVCSR
CGGITGPHASGDEGAAARYGLHVCAGSAGSLTSSASGSSATAGAQRTGSARCAAAAVDEQ
YLYLLMELCSGGDLDRLVRTMARKTLVPRSSWLAQVVGGPAVAWRGLPEAAARFYAAGIL
LALEELHSHFIVYRDLKPGNVLIDDSGYPRLADFGMAKVLNGPTGRATSACGTLDYMLHL
HLTWTRNAPEIVKLECEQLAKEGKAQVLEDLVESRALRRVGPAGGAAAGGGGRNGEAGPG
RRRREDSGQGAYGLGVDWWSYGAVLYVLLTGCKPFCPPEAEAAGEDPTRVLVRIINPWYE
VPLPVYLSPHAKDLLRRLLVRQPKWRLGCGGGGAEEIRAHPFFAGFDWDAYEERKMAPPY
PIQAVSLPHEQEAESVACFFGFYGSSVPEQVPKPAAPGKPQQQPQQQVQAPHRPHPQQPP
TNWLQDF
NT seq 4524 nt NT seq  +upstreamnt  +downstreamnt
atggggcccatttccgctgctcccctgttaatactgacagtggtttgtctcagctcacta
gcagcccgcggtttcgacgtcaggcgtcacctaggcacgaagactcgctacgcctttcgc
ctggcagtttctagctcgccttccgtctacaaagcaccggatccggagggttacgacccg
gtgcatctctatctgctggcccgccatggcacccggtggcccactggcgaccgcatgcgg
caaatcaacagccttgaggcgctgtttgcggatgcccgcaacaccgccgaccacccgtgg
atccgcaactggacggcgcccttctccaatgtggctctgatgggcggcgagctgcacccc
actggggcggacgagctttggaacctggcctatcggttgcggaagcgcttcccctccctc
tctagccaggactacctccccaagcggtttcctgtggtgtccacgcaggttgcccgtacg
gcagctagcgccagcgccttcacgtccggattcttccccggcgtggggaccaaggacctc
gcggacgactcgcgcgacgtcaaccccgagccgcctcgggcgccggcggatgcaaatgcg
gtgcggagcggcggcgaggtgatgaatagcgacccggcgggtcagccgcggcgagtggcc
ctgcagggaggcaggttgaagtccccgctggtggcggccgctgctctccacgaggagctg
gatgagacattgcgggactcgcccaagatccgaagaccccaggcggtggccatcagcatg
gcccccaaggacgccgacccgctactgcgcttcttcgaggtctgtcccgcgtacgcccag
catgacgagttcacggagaagtggatcggcccctggatgcagggcaattggtcccgcctg
gtgcccatcctggagcagcgtctggatctgcctcgtgacatgagcccatgcgaagtggag
gcgctgtggcagctctgcctgctcgaggcggggctgtacgacataaccaaccaggcgtgt
agcctgtttgagccggaggaggtgatgatgctcgagtgggtggacgacatccaccttttg
gagacgcaaagctacggagcgaccatcaactacgaaatagcggcaccgctgctgcacgac
gcgacggaggcgctcaaggcggcggcggcggcggcccacacgccggacggcgcgatggcg
cccgtggctaggttcctgtttgcgcactgcgagacgctggttcctctggctagcttgctg
gggctgttccggccccctgtcccgccgccccctggcgccacctcggcgcagctggcggcc
tccgtgtcccccgcagccgctcagcggcacctgcggaggctggacaccctggaggacctg
cacatgatggcgaccgggctgcagcacctgaatgccattgggcggcggggccccggctcg
ggatctccaggaagcggcggaggcggaggccgcagtcccggtagcatggccagtgaagat
tcccacgtgtgctacaagggccgtcctcccccccccactgactgggtggagccccccgag
ggctggtaccccatgttcacctgcgacgattaccgcatgttcaagggcgcccgcatcgcg
cccttcggagccaacatggcgctggtgctataccggaggagggagggcgatggagctccc
agaggccggcccaagcacctggtacggctgctgtacaacgagcaggtgctgccagtgcct
ggctgcagcagcgccgcgagtggtcgtgggggcgaggggtcggacgagtcattggattgc
gacttggaggagttcctgcagctggtcaaggacaagactgatccgaatgctctggagcgg
ttatgtggcagtgaaggggaggagaacctcgcacggcgggttgagcgtgatttggctcag
caaaccaccttggccacgctggacctgcgaccgaaatgtcgcaacggcgagcagcaacag
gagttcggtcaacctcagcgcctagcttcagacaccggctcttcctgtccgcattgctcc
gcggcctccaactcggacgccctggcgggagtccctagaggcctgtgccagggctctgca
cggggcccgcgtcagggcaaaggcacgcagccctccgctgttgcaaccacagcagcgccg
gctgtcgatatacatctaccttcctgtgctcaccccaccagcgcaggggatgggagagcc
gccgctggtgttgcaggcgctgtgcctgcggtcgcagaagcgcttacagcccacgcgttc
tcccgccttgccgaggctgcagccccgggtcccagccccgacggagtgctatctcccgta
tcgccgccatcctcccgccgcagctccctctccaacttggccgcgctgcccggcacccaa
gatgtcaccttgcataacggtgtcggcctagcttgcaagtcctcctcggatgtggaggcc
gctccttgtgctgcagcagctgctgcggctaccgcagctacctcctctgctccggtgagg
tcgggctccagcaccagcctgtccaccggcagtagccatgaccagcgcgagcagcaggca
tttccccaggctccggcacagggtaagggcctccgggtggagccagcggcgacggtggca
ggcgctgctggaggggaatggttgctcgcagatcaaagggcagcggacaatgcaggggag
ccacggttgcagctgccggctcaggacgtgggattgtgctctatgggcctgcagctaccg
caccggcggccagcaacgctacgtctccgctgcatcgttcgcgaccctgtaaccggctcc
atgttggcgaccgcacggggccatgtggatgatgcgagcttgccgctgtgccgcccgcgg
gcccggcacatggcagcggcggctgccggcgagggcacctgcgcccagcccggtcacctg
ctgtttgtggaggaggcagtgctgggccgcggcgccttcggcttcgtaacgctggtgact
gtcctctgttccagtcctggatccacgcacgcggtcacggagcgttcctacgccctaaaa
cgcctgcgccgctcagccatcagccccaagcatgtgatgcaggagcagcaggccctgcgt
ctgttgatgacggagcagcagcttgccgcatcgagagccgccgcggaagttgctgatggt
ggccagcagcagcagcaggagaaggaaaacctgccgcgaggccgcggcgtctgcagccgt
tgtggaggcatcacaggaccgcatgcgtccggtgatgagggtgctgcagcacgctatggt
ttgcatgtgtgcgcgggatccgctggctccttaacgtcgtcggcgtcggggtcgtccgct
acagctggggcgcagcggaccgggagcgctcgctgcgctgctgccgcggtcgacgagcag
tacctatatctgttgatggagctttgctcgggaggtgatttggaccgcctggtacggacc
atggctcgcaagacactggtgccccgcagcagctggctggcgcaggtggtggggggcccg
gcggtggcgtggcgggggttgcccgaggcggctgccaggttctacgcggcgggtatcctg
ctggcgctggaggagctgcactcgcatttcatcgtgtatcgcgatttgaagcctggaaac
gtgctcatcgacgacagcggctatccccgactggcggatttcggcatggccaaggtcctg
aatggacccacgggtcgcgccacgtctgcttgcggcaccctggactacatgctgcacctg
cacctgacctggacaaggaatgctcccgagatcgtcaagctggagtgcgagcagctggcc
aaggagggcaaggcgcaggtgctggaggacttggtggagtcgcgtgctctgcgacgggtt
gggccggcgggaggggcggcggcgggcggcggcggccgcaatggggaggcagggcccggc
cggcggcgacgcgaagacagcggtcagggcgcgtacggtcttggcgtggattggtggtcg
tacggtgccgtattgtacgtactgttgacgggctgcaagcccttttgcccgcctgaggct
gaggcggcgggggaggacccgacccgcgtcttggtccgcatcatcaatccctggtacgag
gtgcccctgcccgtgtacctcagcccgcatgccaaggacttgctgcggcggttgctggtg
cggcaacccaagtggcgcctgggctgcgggggcgggggcgcggaagaaattcgggcgcat
cccttcttcgcgggcttcgactgggacgcctacgaggagcgcaagatggcgccaccctac
cccatccaggcggtgtcgctgccgcacgaacaggaagccgagtcggtggcatgctttttc
ggcttttacggcagctctgtgccggaacaggtgcccaagcctgcggcaccggggaaaccg
cagcaacagccgcaacagcaggtgcaggcgccacaccgcccacatcctcagcagccaccg
accaactggctgcaggacttttaa

DBGET integrated database retrieval system