KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_105183Help
Entry
VOLCADRAFT_105183 CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00010  Glycolysis / Gluconeogenesis
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VOLCADRAFT_105183
Enzymes [BR:vcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     VOLCADRAFT_105183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C DXP_synthase_N
Motif
Other DBs
NCBI-GeneID: 9615839
NCBI-ProteinID: XP_002951658
JGI: 105183
UniProt: D8TZ32
Position
Unknown
AA seq 622 aa AA seqDB search
MSAPQSLEVTGTPTGGVDSPHAAAASPKPEQKSVKSTTGAVSKAAKAASGHKEHHKYKIP
LASPDANLGVHIANRLVEIGCTTCFAVPGDFNLLLLDQLLKQPELNMVWCCNELNAGYAA
DGYARKRGVGCVCVTFCVGGFSAINAVVGAYSEDLPLIVISGGPNSQDHAANRILHHTTG
LNEYGQQLRAFRECTCCQVVIQHIEDAHMLLDTAISEAMLRRKPVYIEVACNLADLTHPS
FARPPVPYALAVSHTNQASLEAAVEASLEWLGRAVKPVLLQGVRTRPSRTRKAMLDLANS
SRYPVAVMPDAKGFFPEDHPQFIGMYWGPVSSPCVCEVVESSDVVICVGGVWTDYSTTGY
SLLLKPEKMIRVDGNRVTIGHGPTFGCIVMADFLEALAARVKPNDTGHVIFKRMVLPTTE
PPPQQPGEMLRTNVLFKHIQHMLTPTTSLISEVGDSWFNTLKLKLPPGAEYELQMRYGSI
GWSVGAVLGYSCAEKQTNPERRVVACIGDGSFQMTAQGPYNVIKNWDYTGLVRAFHNGQG
KLWTAEDPGPVPLRILRFIHKARTETELEAAISEAVRRRGELCFIMAVTHRDDCSKELLE
WGSRVAAANSRKPGAAQAGSGH
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcaccgcaatcgctcgaggttactggaacccccacaggaggcgttgactctccg
cacgccgccgcggcctcccccaagcctgagcaaaagtccgtcaagtcgacgaccggagct
gtcagcaaggccgcgaaggccgcatccggccacaaggaacatcacaagtacaaaatcccg
ctggccagcccggatgcaaatctcggagtgcatattgccaaccggctggtggagatcgga
tgtacgacctgcttcgccgtaccaggtgacttcaatttgctgctcctggaccagctcctg
aagcaacccgagctcaacatggtgtggtgctgtaacgagctgaatgcgggatatgcggcg
gacggctacgcgaggaagaggggtgtggggtgcgtgtgtgtcaccttctgtgtgggaggt
ttcagcgccatcaacgccgtggtgggtgcgtattccgaggacctgcccctcatcgtcatc
tccggggggcccaactcgcaagaccacgcggccaacaggattctgcaccacaccacggga
ctgaacgaatacggtcaacagctgagggcgttcagggaatgcacctgctgccaggttgtg
atccagcacatcgaggacgcgcacatgttgctggacacggccatcagcgaggccatgctg
cggaggaagcccgtgtacattgaggtggcctgtaatctggcggatctaacccaccccagc
tttgctcgtccaccggtgccgtacgcgctggcggtgtcgcacaccaaccaggcctccctg
gaggcggcggtggaggcgtccctggagtggttgggtcgggcggtgaaaccggtgctgttg
caaggtgttcgtacccggccctcccgtactcgtaaagccatgctggacctggccaactcc
tccaggtacccggtggcggtcatgccggacgccaagggcttcttcccggaggaccaccca
caattcataggcatgtattggggccccgtgagcagcccctgcgtgtgcgaggtggtggag
agctcggatgtcgtaatttgtgtgggtggagtatggactgactactccacgacgggctac
tcgctgctgctaaaaccggagaagatgatccgagttgatggcaaccgcgtcacgatcggt
cacggacccacgttcggctgcatcgtgatggcggacttcctggaggcgctggcggcgagg
gtaaaacccaatgacacgggccacgtcatcttcaagcgcatggtgttgcccaccacagag
ccgccgccgcagcagccgggcgagatgctgcgaacgaatgtcctgttcaagcacatccag
cacatgctcacgcccaccacctctctgatttccgaggtcggcgactcctggttcaataca
ctgaagctcaagctgccgcccggggcagagtacgagcttcagatgcggtacggctccatc
ggctggtccgtgggtgccgtactgggttatagctgcgcggagaagcagacgaatccggag
cggcgggtggtggcgtgtatcggggacggctccttccaaatgacggcgcaggggccatac
aacgtaatcaagaactgggattacaccggacttgtacgggcgtttcataacggccagggc
aagttgtggactgccgaggaccccggccctgtccctctccgcatccttcggttcatacat
aaggcccgtacggagacggagctggaggccgccatctccgaggctgtacggcggcgcggg
gagctgtgtttcatcatggcggtgacccaccgggacgactgcagcaaggagctgctggag
tgggggagccgagtggcggcggcgaacagccgtaagcccggggccgcgcaggcgggtagc
ggccactga

DBGET integrated database retrieval system