KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_105396Help
Entry
VOLCADRAFT_105396 CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K06195  ApaG protein
Organism
vcn  Volvox carteri f. nagariensis
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    VOLCADRAFT_105396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR HlyD_2
Motif
Other DBs
NCBI-GeneID: 9628511
NCBI-ProteinID: XP_002952261
JGI: 105396
UniProt: D8U0J9
Position
Unknown
AA seq 279 aa AA seqDB search
MATTLYRSTINLHRPTAGTSGRAAIIRQVPWSGSRCLRLLPRAAEADTAPNPSPGIGELI
QRRKDIELEIKLAVKGEDFKAAARLKEELEALNRKDPVMVAKKALEQAIKEERYEDAARI
KAQIKQLEDELGPAALMEAGLITTQSTAITRGIKVQVQSFYLPTKSSPSAGRYMFAYHVT
ITNETTDAIVQLRNRHWIITDARGKTEEVRGPGVVGEQPILLPGKSHEYTSGCPLSTPQG
SMEGEYTMVVLSPEDGQWAETIEVKIGKFMLDSKGPKAI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacattgtaccggtctacaattaacctacacagaccaacagctggaacatca
gggcgtgcggctatcattcgccaggtcccatggagtggaagccgctgcctgcgactgttg
cctcgcgctgctgaggcagatacagcgcccaatccgtcgcctggcattggggaactcatc
caacggcggaaagatattgagttggaaataaaacttgcggtcaaaggcgaggacttcaaa
gcggctgcccgattgaaagaggagctggaagcattaaaccgcaaggacccggtcatggtc
gcaaagaaagctttggagcaagccatcaaagaagaacgatatgaagacgccgcccgcatc
aaggcccagatcaagcagctggaggacgagctaggtcccgctgctctgatggaggccggg
ttgatcactacacagagcactgctatcacccgggggattaaagtacaggtgcagagcttc
tacctgcccaccaaatcgagtccctcggcaggtcgttacatgtttgcctaccacgtgacc
atcaccaacgaaacaactgacgctattgtacagctccgaaaccgccactggattatcacg
gacgcgcgagggaagacggaggaagttagggggccgggggtagtgggagagcagccgatc
ctgctgcccgggaagagccacgaatacacgtcggggtgtccgctatccacaccacagggc
tccatggagggtgaatacacgatggtggtgcttagtccagaagatggacagtgggcggag
acgatcgaggttaaaattgggaagttcatgctggactccaagggcccgaaggccatttga

DBGET integrated database retrieval system