KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_105923Help
Entry
VOLCADRAFT_105923 CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00260  Glycine, serine and threonine metabolism
vcn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
vcn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    VOLCADRAFT_105923
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    VOLCADRAFT_105923
Enzymes [BR:vcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     VOLCADRAFT_105923
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG NanE Spore_YtrH PcrB
Motif
Other DBs
NCBI-GeneID: 9625819
NCBI-ProteinID: XP_002953501
JGI: 105923
UniProt: D8U4B5
Position
Unknown
AA seq 261 aa AA seqDB search
MNSNPRERSRSFLLSARGTQISTRLLQLSASWMRLAQMSLNLECRTRYAGKDPLADGPVI
QGAATRALEKHTTLDRVIEMVRRTAPAMKAPLVMFTYFNPIMRKGLDKFCKTIKEAGASG
LLVPDLPLEETVAVRAACEAAGIELVLLTTPTTPQARMSAIAQASQGFVYLVSLTGVTGM
KDQVESRVEGLVRTLQDVTDKPICVGFGVSRPDQAKQIVSWGANGVICGSALVKALGEAK
SPAEGLQAMEDLARSLRAAIP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaaatccaagggaaaggtcgcgttcattccttttatctgcgcgggggacccag
atctcgacacgacttctgcagctctccgcaagctggatgagattggcgcagatgtcattg
aacttggagtgccgtactcggtacgctgggaaggatccgctggcagatggtcccgtcatc
caaggcgcagccactcgtgcgctggaaaagcacacgactctcgatcgcgtcattgagatg
gttcgcaggacggcgccggccatgaaggcgcccctggtcatgttcacttacttcaaccca
atcatgcggaagggcctcgacaagttctgcaagacgatcaaggaggcgggcgcatcaggc
ctcctggttccagaccttcctttggaggagacggtggctgtacgggcggcatgtgaggct
gcgggaattgagctggtcttgctgacaacgcctaccacaccacaagcccgcatgagcgcg
attgcgcaggcgagccagggcttcgtgtacctggtctcactgacgggggtgacgggcatg
aaggaccaggtggagtcgcgtgtggaggggctggtgcgcacgctgcaggacgtcacggac
aagccgatttgcgtgggcttcggtgtgtcgcgcccggaccaggcgaagcagattgtgtca
tggggtgccaacggcgtcatttgcggaagcgcccttgtgaaggcattgggtgaagccaag
tccccggcggagggtctccaagccatggaggaccttgcgcggagtttgcgcgctgctatt
ccatga

DBGET integrated database retrieval system