KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_106350Help
Entry
VOLCADRAFT_106350 CDS       T01330                                 

Gene name
pck4
Definition
(RefSeq) phosphoenolpyruvate carboxykinase
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00010  Glycolysis / Gluconeogenesis
vcn00020  Citrate cycle (TCA cycle)
vcn00620  Pyruvate metabolism
vcn00710  Carbon fixation in photosynthetic organisms
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
vcn01200  Carbon metabolism
Module
vcn_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VOLCADRAFT_106350 (pck4)
   00020 Citrate cycle (TCA cycle)
    VOLCADRAFT_106350 (pck4)
   00620 Pyruvate metabolism
    VOLCADRAFT_106350 (pck4)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    VOLCADRAFT_106350 (pck4)
Enzymes [BR:vcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     VOLCADRAFT_106350 (pck4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_ATP AAA_16 AAA_33
Motif
Other DBs
NCBI-GeneID: 9624407
NCBI-ProteinID: XP_002954405
JGI: 106350
UniProt: D8U6R4
Position
Unknown
AA seq 580 aa AA seqDB search
MLRYASDNMPNGADAKFLMDSNFTRQSGLAPRQIFRNLPPSQLYEMALAFEPGTHITSTG
ALATLSGEKMGRSPKDKRIVRDPETEKDLWWGPYSPNYVMDDRTFLTNRERAVDYLNTLD
RIYIVDAFANWDPASRLKIRVVTSRAYHALFMHNMLIRPTPEELEDFGEPDFVIYNAGAF
PANKYTNFMTSQTSIDLCLKHKEMVILGTMYAGEMKKGVFTLMHYLMPMQGKLSLHSGCN
VGAEGDVTLFFGLSGTGKTTLSADPKRPLIGDDEHVWCDTGVFNIEGGCYAKCIGLKKET
EPEIWNAIRFGTVLENVDYDPDSRLVDYDSQRLTENTRASYPIEYISNAHVPCVGGHPKN
VILLACDAFGVLPPVSRLSLEQAMYHFISGYTAKVAGTEVGVKEPTATFSACFGSAFLML
HPYKYATMLADKMSKHGTHAWLVNTGWTGGKYGVGKRISLKYTRAIIDAIHTGELEKAEY
VSTPIFGLQVPVSVSGVPPEILSPESVWPNKNEFATTLNHLGHMFVKNFECFSDGDSFVG
AEMASRILTGGPSPLPEDHVAKTGFGAIISAAATAPAIQA
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgctacgcctcggacaacatgccaaacggcgctgatgctaagttcctgatggac
agcaactttaccaggcagtcgggcctggcaccgcgtcaaattttccgcaatctgccaccg
tcacagctttatgagatggccttggccttcgagcctgggactcacatcacatctactggc
gcgctggcaactctgtcaggcgagaagatgggccgcagcccgaaggacaagcgtatcgtg
cgtgaccccgagaccgagaaggacctttggtggggcccttactcgccaaactacgtcatg
gatgacaggaccttcctgaccaaccgagagcgcgccgtcgactatttgaacacacttgac
cgcatctacatcgtggatgcatttgccaactgggaccccgcttcgcgcctcaagatccgc
gtcgtgaccagccgggcctatcatgcactgttcatgcataatatgctcatccggccgact
cctgaggaacttgaggactttggggagccagactttgtgatctacaatgcgggcgccttc
cccgctaacaagtatacgaactttatgacgagccagacgtccatcgacttgtgtctgaag
cacaaggagatggtcattttggggaccatgtacgcgggcgagatgaagaagggagtgttc
acgttgatgcactacctgatgcccatgcagggcaagctgtcccttcactcgggctgcaac
gtgggcgcggagggagatgtgacgttgttcttcggactgagtggcaccggcaagaccacc
ttatcggcggacccgaagcggcctctgattggcgatgatgaacacgtttggtgcgacacc
ggcgtgttcaatatcgagggcggctgctacgccaagtgcatcgggctgaagaaagaaacc
gagcccgagatctggaatgccatccgtttcggcactgtgttggaaaatgtggactacgac
ccggactctcgccttgtggactatgactctcaacgactaacggaaaacacgcgcgcctcg
taccctatcgagtatatttccaatgcgcacgttccctgcgttggcggccaccccaagaac
gtcatcctgctcgcgtgcgacgccttcggagtccttccgcccgtcagccgactctcacta
gaacaggccatgtaccacttcatcagcggatacacggccaaggttgccggcactgaggtt
ggtgttaaggagcccacggcgaccttcagtgcttgctttggctcggccttcctcatgcta
cacccgtacaagtacgccaccatgttggctgacaagatgtcgaagcacggcactcacgcc
tggttggtcaacacgggctggactggcggcaagtacggcgtcggcaagcgcatcagcctg
aagtacactcgcgccatcattgacgccatccacaccggggagctggagaaggccgagtac
gtctcgacccccatctttggacttcaggtgcccgtgtccgtgagcggtgtaccgccggag
attctgagtcccgagagcgtgtggcccaacaagaacgagttcgcgaccacattgaatcac
ctggggcacatgttcgtgaagaacttcgaatgcttcagcgacggcgactcttttgttggt
gcggagatggcgtctcgcatcctcaccggcggcccctcccctcttccggaggatcatgtg
gccaagaccggcttcggagcaatcatctcggctgccgcaacggcacccgcaatccaggcc
taa

DBGET integrated database retrieval system