KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_107549Help
Entry
VOLCADRAFT_107549 CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VOLCADRAFT_107549
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     VOLCADRAFT_107549
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-GeneID: 9620658
NCBI-ProteinID: XP_002957125
JGI: 107549
UniProt: D8UES1
Position
Unknown
AA seq 311 aa AA seqDB search
MLAYAARSRRGYSSILAAAALSGTAYAALNIDEKLAVKAVHADAPAGKGALDPNEFRAFK
LKEKRQLTRNTFLYRFELPEGQTSGIFVASCLVTRAMLKAKPEDEKPKAVIRPYTPTSPP
DAKGYLDLVVKVYDKGVMSKHIDSLKIGDSLEIKGPIKKYPYEANTKKHIGMVAGGTGIT
PMLQVIDAILDNPNDKTQVSLVYANVSESDIILQDKIDALAAQHPGRFKVYYVVDKPAWG
GLFWRGGVGYLTKDMLSKHLPAPAKDSLVMVCGPPGMMEAVSGNKAPDYSQGEVKGLLKE
LGYDSSSVFKF
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcctacgcagcgcgctcccggcggggatacagctccatccttgcggccgcagcc
ctttctggcactgcatatgcagctctgaacattgatgaaaagctagccgttaaggctgta
catgcggatgcgccagcgggcaagggtgcattggatccgaacgagttccgcgcctttaag
ctgaaggagaagcggcagctcacgcggaacactttcttgtataggttcgagctcccggag
ggtcagacttcgggcatcttcgtggcctcatgcctcgtgactcgcgcaatgctgaaggcg
aaaccggaggatgagaaacccaaggcggtcattcggccgtacaccccgacttcgccaccg
gatgccaagggctacctggaccttgtcgtcaaggtgtacgacaagggcgtcatgtcgaag
cacatcgactccctcaagatcggtgacagtttggagattaaggggcccattaaaaaatac
ccttacgaagccaacactaagaagcatattggtatggtggcgggaggaactggcatcacc
ccaatgctgcaggtcattgatgcgattttggacaacccgaatgacaagacgcaggtgtcg
ctggtgtatgccaacgtcagcgagtcggacattatcctccaggacaaaatcgacgctcta
gccgcacaacacccgggccgcttcaaggtgtactacgtggttgacaagcctgcttggggc
ggtttgttctggcgcggtggcgttggctacctaactaaggacatgctatccaagcacctg
ccggcccccgccaaggattcgctggtgatggtgtgtggccctccgggtatgatggaggca
gtgtcgggcaacaaggcacctgactactcgcagggtgaggttaagggcttgctcaaggag
ctgggctatgactcatccagcgtgttcaagttttaa

DBGET integrated database retrieval system