KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_109643Help
Entry
VOLCADRAFT_109643 CDS       T01330                                 

Gene name
chlM
Definition
(RefSeq) magnesium protoporphyrin IX S-adenosyl methionine O-methyl transferase chloroplast precursor
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00860  Porphyrin and chlorophyll metabolism
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VOLCADRAFT_109643 (chlM)
Enzymes [BR:vcn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     VOLCADRAFT_109643 (chlM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_23 Methyltransf_25 Methyltransf_12 Methyltransf_11 Methyltransf_31 PrmA Methyltransf_32 MTS
Motif
Other DBs
NCBI-GeneID: 9621220
NCBI-ProteinID: XP_002947884
JGI: 109643
UniProt: D8TNN2
Position
Unknown
AA seq 335 aa AA seqDB search
MQCLNQKPFTATRPVAKCARRVIRCNAQSRQTDAVLKATAGAAALAFASTSTAHAAEILS
SATGLDGSLTFAVGGGVAIAGLGALLVATDPQKRRTEQMAQTGGDEKEAVKNYFDTAGFE
RWRKIYGETNEVNKVQLDIRTGHAQTVDKVLRWVDEEGSVAGLTVCDAGCGTGSLAIPLA
LRGAAVSASDISAAMAGEAERRYQTALSASGSKAPKLAPKFEAMDLESIQGSYHTVTCLD
VMIHYPQDKVDGMITHLASLANTRLIISFAPKTLSYSILKRIGELFPGPSKATRAYLHRE
EDVEAALQRAGFKVTKREMTATSFYFSRLLEAVRV
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgccttaaccaaaagcccttcacggccacacggcccgttgccaagtgcgcacgc
cgcgtaattcgctgcaatgcgcagtcgcgccagaccgatgctgtcctgaaggccacagct
ggcgctgcagcgcttgctttcgcttccacctccacagctcatgctgctgaaattttgagc
tctgcaaccggccttgatggctcgcttactttcgctgtgggcggtggcgtggctatcgct
gggctcggggcgcttcttgtcgctacagatccccagaagcggcgcacagagcagatggcg
caaactggaggagatgaaaaggaggcggtgaagaactacttcgacaccgctgggtttgaa
cgatggcgcaagatttatggtgaaaccaacgaggtcaataaggtacagctggatattcgc
acagggcatgctcagactgtggacaaggtgctccgctgggtggacgaggagggcagcgtt
gccggccttactgtgtgtgatgctggctgcgggacaggcagcctggccatcccgcttgcc
ttgcggggagcggcagtgagcgcgagcgacatcagcgcggctatggctggcgaagccgag
cggaggtatcagacggcgttaagtgcgtcgggcagcaaggcacccaagctggctcccaag
tttgaggcgatggatctcgagtccattcagggcagctaccatactgtcacctgcctagat
gtgatgattcactaccctcaggacaaggtggacggcatgatcacccacctggcgtccctg
gcaaatacccgcctcatcatatcctttgcgcccaagactctgtcttacagcatccttaag
cgcattggcgaattgttcccggggcctagcaaggctacacgcgcgtacctgcaccgggag
gaggatgtggaggcggcgctgcagcgcgctggtttcaaagtgaccaaacgcgagatgacc
gcgaccagcttctatttttcgcgcctgcttgaagccgtgcgtgtatga

DBGET integrated database retrieval system