KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_121058Help
Entry
VOLCADRAFT_121058 CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K06634  cyclin H
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn03022  Basal transcription factors
vcn03420  Nucleotide excision repair
Module
vcn_M00290  Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    VOLCADRAFT_121058
  Replication and repair
   03420 Nucleotide excision repair
    VOLCADRAFT_121058
Transcription machinery [BR:vcn03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     VOLCADRAFT_121058
DNA repair and recombination proteins [BR:vcn03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     VOLCADRAFT_121058
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cyclin_N Cyclin_C_2 IATP
Motif
Other DBs
NCBI-GeneID: 9628570
NCBI-ProteinID: XP_002952397
JGI: 121058
UniProt: D8U0Y2
Position
Unknown
AA seq 367 aa AA seqDB search
MWRGGLGASMDFATSTHRRRWLYTRSKLEEERRRLQQAVVDGLRRQRAAADPLEPEAGSA
TKRPREDPQPVSLVGELLMLKYSQQIIQEKCREMRMPVKVMSTAIQYHKRFFLRHTSMEF
DPGRVMITAIFMATKVEERYTRAADIAAAFDVSEDLVVKQEVALMEGLNFDLVVHSPYRA
LHGMILVVDEACRAAGGALDALMLSDAPLLYSPAQVAAAALRSGFKAKGVRIPNFIARLA
MKAALRAAEGEEGVGVDGGAGAEAAGAQNDPVTALTSVLDELDRLGSEGARRVEVDEVKE
ANAVARQWRSLLKDTTGGAAAGAGKGGGGGGAVADEAARVAKREAKKAARAAAKAKEAEL
LGMPQRQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtggcgtggtgggctcggcgcaagtatggacttcgcaacatccacccaccggcggaga
tggctctacacaagaagcaaattggaggaggagcggaggcggctgcagcaggcggtggtg
gacggactcagacgtcagcgagcagctgcggacccgctggagccggaggcgggcagcgcg
acgaagcgacccagagaggacccacagcccgtgtctctggtgggggagctgctcatgctc
aagtactcccaacaaatcatacaggaaaagtgtcgtgagatgcggatgccggtcaaggtg
atgtccacggccattcagtaccacaagcgcttcttcctgaggcacacatcgatggagttc
gatccagggagggtcatgatcaccgcaatattcatggcgacaaaggtagaggagcgctac
acgcgggctgcggacatcgcagcggcgttcgatgtgagcgaggacctggtggtgaagcag
gaggtggccctaatggagggcctcaacttcgatcttgtcgtacattcgccgtacagagca
cttcacgggatgattctggtggtggatgaggcgtgtagggccgcggggggggccctggat
gccctcatgctcagcgatgcgccgctgttgtacagccctgcgcaagtggcggcggcggcg
ttgcggagtgggttcaaggcgaagggtgtgcggatacccaacttcatcgcccggttggca
atgaaggcggcgttgcgggcggcggagggggaggagggggtgggggtggacggcggggcg
ggagctgaggcggcgggtgcgcagaacgaccccgtcacggcgttgacttccgtactggac
gagctggaccggctgggcagcgagggtgctcggagggtggaggtggatgaggtgaaagaa
gccaatgcagtggctaggcagtggaggagcttgctcaaggacacgacggggggggccgcg
gcgggagcgggcaagggtggtggtggtggtggggcagtcgcggatgaagccgctcgggtc
gccaagcgggaggccaagaaggcagctcgcgccgctgccaaggcgaaggaggcggaactg
ctaggcatgccacagcggcagtag

DBGET integrated database retrieval system