KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_42929Help
Entry
VOLCADRAFT_42929  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    VOLCADRAFT_42929
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     VOLCADRAFT_42929
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     VOLCADRAFT_42929
DNA repair and recombination proteins [BR:vcn03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     VOLCADRAFT_42929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH RNA_pol_3_Rpc31 Myc_N Ribosomal_60s Pox_Ag35 DUF1943
Motif
Other DBs
NCBI-GeneID: 9617296
NCBI-ProteinID: XP_002954128
JGI: 42929
UniProt: D8U5Z3
Position
Unknown
AA seq 325 aa AA seqDB search
MPELPEVEAAKRLMERGCVGKRIERVVAAKDDKVFEDASPDDVRRALEGRRVVAAHRKGK
YLWLELDNPDGLWPLLHFGMTGGIVVQNMGATKYKRIHLASNPDEWPPRFTKLELDLEGG
AKVAFVDVRRFGRVKLLANPSAQEPLSKLGFDVLDELPPLEQFIAAVRKRVARAPGLKIK
ALLLDQEFCSGIGNWVGDEVLYQARIHPEQSAASLGDSALAALRESIRSVVTQAVELEAD
VDRFPPEWLFHHRWNSRKPGSINGHKIEFVTVGSRTSAFVPALQKLQGPRTGAAKKKKTA
SDSEEEEEEEEEEEEEEEEEEEEEE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctacctgaggtggaagcagcgaaaaggcttatggagcgaggctgtgtgggc
aaacggattgaaagagttgtggctgcgaaagacgataaggtcttcgaggacgcgtctccg
gatgatgtacggcgtgctctggagggtcggcgggtggttgcagcccaccgcaagggcaag
tacctgtggctggagctggacaaccccgacgggctctggcctctgctacattttggcatg
acgggcggcatcgtggttcagaacatgggtgcgaccaaatacaaacgtattcatttggca
tcaaacccggacgagtggcccccacgcttcaccaagctggagttggatctggagggtggc
gccaaggttgcgttcgtggatgtgaggaggtttggccgcgtgaagctgctcgccaaccct
tcagcacaggagccgctctccaaattgggttttgatgttttggacgagctaccgcctctg
gagcaattcatcgcggcagttcggaagcgggtggcgagagcgccgggtctcaaaattaag
gctttgctcttggaccaggagttctgtagcgggattggcaactgggtgggcgacgaggtt
ctgtaccaagcccgcattcacccggagcagtcagcggcctccctgggggattccgctctg
gcggccctccgcgagtccatccgctcagtggtgacacaggctgtcgagttggaggcagat
gtggaccgcttcccccccgaatggctcttccatcaccggtggaacagcaggaagcccggg
tccatcaacggccacaaaatcgagttcgtgacggtggggtcgcgcacctcggccttcgtg
cccgccctccagaagctccaagggccccgcacgggcgccgctaagaagaagaagacagcc
agcgacagcgaggaggaggaagaggaggaagaggaggaagaggaggaagaggaggaagag
gaggaagaggaggaa

DBGET integrated database retrieval system