KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_43639Help
Entry
VOLCADRAFT_43639  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K20115  [pyruvate, phosphate dikinase]-phosphate phosphotransferase / [pyruvate, phosphate dikinase] kinase [EC:2.7.4.27 2.7.11.32]
Organism
vcn  Volvox carteri f. nagariensis
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VOLCADRAFT_43639
Enzymes [BR:vcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.27  [pyruvate, phosphate dikinase]-phosphate phosphotransferase
     VOLCADRAFT_43639
   2.7.11  Protein-serine/threonine kinases
    2.7.11.32  [pyruvate, phosphate dikinase] kinase
     VOLCADRAFT_43639
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinase-PPPase
Motif
Other DBs
NCBI-GeneID: 9621240
NCBI-ProteinID: XP_002947899
JGI: 43639
UniProt: D8TNR7
Position
Unknown
AA seq 159 aa AA seqDB search
SLTDEYFRMIEAVEYTRKMDDGAHPQEWVNADLVILGVSRCGKTPLSIYLGQRGYKVANL
PLIPGCPVPRELYDIDQTRIVGLIIDPNVLATIRRNRVNIMGVSRAQAIDYAEVKKINSE
LDWARKLYNSNPEWPVIDVTLRGIEETAARILKMLNDRR
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
agcctcaccgacgagtacttccgaatgattgaggcagtggagtacactcgcaagatggac
gacggtgcccacccgcaggagtgggtgaatgccgacctggtcattctgggggtgtcgcgg
tgcggcaagacgccgttgtccatctacctgggccagcggggatacaaggtggccaatctg
ccgctcattcccggctgcccggtgcctcgtgagctgtacgacatcgaccagacccgcatc
gtgggccttatcatcgaccccaacgtgctcgccaccatccggcgcaaccgagtgaacatc
atgggggtgtcgcgagcgcaggccatcgactacgcggaggtcaagaaaatcaactcggag
cttgactgggctcgcaagctgtacaactcgaaccccgagtggcccgtcattgatgtgacg
ttgcgagggatcgaggagacggcggcacgcatccttaagatgctcaacgaccggcga

DBGET integrated database retrieval system