KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_74532Help
Entry
VOLCADRAFT_74532  CDS       T01330                                 

Gene name
cbr1
Definition
(RefSeq) NADH-cytochrome b5 reductase
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    VOLCADRAFT_74532 (cbr1)
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     VOLCADRAFT_74532 (cbr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_6 NAD_binding_1 FAD_binding_9 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 9619700
NCBI-ProteinID: XP_002950124
JGI: 74532
UniProt: D8TUY1
Position
Unknown
AA seq 291 aa AA seqDB search
MAPTQSLPPSLDDLLVFAKANWQLVLPVVVIILALALVLLLKRPKEKKPFLDPSEFKPLP
LTEKTYITHNTVRLRFSLPDPKQRLGLPIGQHITFLAKGDDGKDIYRPYTPVSDDDQLGS
VDFVIKIYPQGKMSQVIAKMRVGDTMLMKGPKGRFIYAPNMVKNFGMLAGGTGITPMFQV
LNAVLKDPKDRTRITLLYGNLTEDDILLRKELDQLVAMHGDRLSVFHVLNNPPASGWQGG
SGFITKEMIAERLPAPGPGHMVLRCGPTPMCNAMKQHLDELGFGEEAQFQF
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcacctacacaatcattaccgccgtctttggatgatcttctagtatttgcaaaggca
aactggcagttggtgctgccggtcgtcgtcatcatcttggctttggcgctggtgttactg
ctgaagaggccgaaagaaaaaaagcctttccttgacccaagcgagttcaagccgttaccg
ctcacagagaaaacctatataacacataacactgtgcgtctccgattctcactaccggat
cctaagcaacgtttagggctgcccatcggtcagcacattacgttccttgcgaaaggtgac
gatgggaaggacatttaccggccttacaccccggtttccgatgatgaccagctgggcagc
gtcgatttcgtcatcaagatctaccctcaagggaaaatgtcgcaagtgatcgctaaaatg
cgagttggagatacaatgcttatgaaaggtcctaagggccgcttcatctacgcgcctaac
atggtgaagaattttggcatgctggcgggcggcacgggcatcacgcccatgtttcaggtg
ctcaatgcagtcctcaaggaccccaaggatcgtacccgcataacacttttgtacggtaat
ttgacggaggatgatatcctgcttcgcaaggagctcgatcagcttgtagccatgcacggt
gaccgcctgtccgtatttcacgtgctcaacaacccgccggcgagcggctggcaggggggc
agcggcttcatcactaaggaaatgattgcggagcgcctaccggcccctggccctggtcat
atggttctccgctgtgggcccacccccatgtgcaacgccatgaagcagcatctggacgaa
ttgggattcggggaggaggcgcagtttcagttttga

DBGET integrated database retrieval system