KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_76078Help
Entry
VOLCADRAFT_76078  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
vcn  Volvox carteri f. nagariensis
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VOLCADRAFT_76078
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     VOLCADRAFT_76078
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 9617184
NCBI-ProteinID: XP_002953937
JGI: 76078
UniProt: D8U5R3
Position
Unknown
AA seq 663 aa AA seqDB search
MDSQALLIVCFVVVVAALALLSIRRKTLKGTAPVPSAGVNGYALPRPSIADDPGKPVVRI
LYGTQTGTAERFSKQLGNDLRSRYGDSTVVDVRDVETYKADQKLVTEKFVVFCMATYGDG
EPTDNAAVFYSWLLKEAEAVESGGREPFLQGLSYAVFGLGNKQYEHFNAVGKKVYKSLKT
CGATPIVRRGDGDDDGVIDDDFEKWCAELLDVLDKSQLVGTRVDHGAHHAAPICVPSYDV
DVVRSMETREVAAFPSGSGKDVHSPFWAKITAVRELHTSQSDRSCVHVEVDVGGSGISYE
AGDHIALYAQNGEAAVKAVADLLGFDLDARIVLSMPRSTSSGDSGRSSDLPPPFPGPISI
RTALSYFADVLSSPHRDALLALSTFAADREEAARLAHLGSSLGKQDYAEFIGKPHRSLLE
VLQAFPSAKPTIGAFFGCIAPRLQPRFYSISSSPKQHPTSIHITCAVVRDLMPTGRVHEG
VCSTWLKRHGMGAVVPVFVRHSQFKLPQSPKTPLIMVGPGTGLAPFRGFLQERATQLASG
VELGPAHLFFGCRSRHHDYIYQEELEGYVASGVLSNLHLAFSRDQAAKDYVQHHLESQGA
ALWPLISEGGAHLYVCGDAKNMAKDVHKAFISLVQNTKGCTGTQAESIMKELSDYGRYQR
DVW
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atggactcacaagctttgttgattgtttgttttgttgtggtggtggcggctctagcactg
ctctcaattcgtaggaagacgttaaaaggcactgctccagtgccttcggctggcgttaac
ggctacgctctgccgcggccgtcaatcgcggacgaccctggcaagcccgtcgttaggatt
ctttatggtactcaaacgggcacagctgagcgcttctccaaacaacttggaaacgacctg
cgcagccgttatggcgatagcactgtggtggatgtgcgcgatgtggagacgtacaaggca
gaccagaaactcgtcacggaaaagtttgtggtgttctgcatggccacatacggagatgga
gagcccactgacaacgcagcagtcttctattcctggttgctaaaggaggcagaagcagtg
gagagcggaggaagggagcctttcttgcagggtctctcgtacgccgtcttcggcctgggg
aacaagcagtacgagcactttaatgccgtcggcaagaaggtgtacaaatcgcttaaaacg
tgcggcgcaacaccaatcgtccgtcgcggtgatggcgacgacgatggcgtcattgatgat
gactttgagaaatggtgcgcggagctgctggacgtgctggacaagtcccagcttgttggc
acgcgcgtcgaccatggtgctcatcacgctgcacctatatgcgtgccttcttacgatgtt
gatgtcgtacgcagcatggagacgcgtgaggtggcagccttccccagcggctccggcaag
gatgtccatagcccgttttgggccaagattacggctgtgcgggagctgcacactagccaa
tcagaccgcagttgcgtgcatgtggaggtggacgtcggcggctccggtatttcgtatgag
gctggtgaccacattgccctctatgcccagaacggagaagctgccgtgaaggcagtcgcg
gaccttctgggtttcgacctggacgcgcgcatcgtgttgtccatgccccgaagcactagc
tctggtgacagtggtcgaagcagcgatttgccacctccattcccagggccgattagcatc
cgtacggcgctttcctactttgctgatgtactctccagcccacatcgcgatgccctgttg
gcgctgtcgaccttcgctgcggatcgggaggaagccgcgcgactggcgcacctgggctcg
tccctggggaaacaggattatgccgagtttattgggaaaccgcaccgcagcctgctcgag
gttctgcaagcattcccgtccgcaaagcccactatcggagcgttttttggctgcatcgcg
ccgcgccttcagccacgattctactcaatatcttcctcgcccaagcagcatcctacgagc
attcacattacctgcgcagtggtgcgcgacctgatgcctacgggtcgcgtccacgagggt
gtttgctcgacgtggctgaagcggcatggaatgggcgcagtcgtgcccgtatttgtgcgg
cactcgcagtttaagttgccgcagtcaccgaagacaccgctcattatggtgggcccgggc
acaggcctcgcacctttccgtggcttccttcaggaacgcgcaacacagctagcatcgggt
gtggaactaggtcccgcccatttatttttcgggtgtcgctcgcggcatcatgactacata
tatcaggaggagctggagggttacgtggcctcgggcgttctgtcgaatcttcacctcgcc
ttttcccgggaccaagctgccaaggattacgtgcaacaccatttggagagccagggagca
gctttatggccgctcatttcagagggcggcgcgcatttgtacgtttgcggtgacgccaag
aacatggctaaggacgtgcacaaggcgttcatttcattggtgcagaacacgaaaggttgc
acggggacgcaggctgagtcgatcatgaaggagctgtcagattatggtcgatatcagcgg
gatgtgtggtga

DBGET integrated database retrieval system