KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_76599Help
Entry
VOLCADRAFT_76599  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
vcn  Volvox carteri f. nagariensis
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VOLCADRAFT_76599
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     VOLCADRAFT_76599
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox DAO Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 9626292
NCBI-ProteinID: XP_002955192
JGI: 76599
UniProt: D8U989
Position
Unknown
AA seq 444 aa AA seqDB search
MDSSTKTSRPRLVVLGSGWGAMSFIKSLPANISEMYEVVVVSPRNYFLYTPLLPAVATGT
MEERSIVEPVRNFIIGKEGGRGRRLLCSCSRACPLRRCCFPAAAAAATAAAAAAVATAAA
AAVGSVNNTFGIRGVDQYCFYFKSIEDAGRLRARVSECFERAALPATPEEERKKLLTFVV
VGGGPTGVEVAAELYDMIECDLSKLYPNIVSIQIVELMDHVLSTYDRAISIYTAEQFKRA
GIKLVLNSRVAAVEDGCVRVVNKANEVTEIKFGACVWATGIAMNPLIRQLQEKLPGQSHF
RSVLTDECLRVKGSDGSIWALGDAATIDQPKVSGWVANQQGKYLAKVFSSTKITGNPEGG
GLRVRVRARARARGGWYFHKGSAAYVGSDKAVFDLPRLGPLTGTGAGFVWKSYETMSQFS
FRNQCLVAADWLRTKIFGRDISRV
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggactctagcactaagacgtcgcgaccgcgcctggtcgtcctgggttctggctgggga
gcgatgagcttcatcaagagtcttccggccaacatcagcgaaatgtatgaggtggtcgtg
gtgtcgccccgcaactactttctgtacacgcctcttctcccagccgttgcgaccggcacc
atggaggagcggtcaatcgtggagccggttcggaacttcatcatcggcaaggagggggga
aggggtaggcggcttctgtgtagctgctcccgtgcctgccctctccgacgatgttgtttt
cctgctgctgctgctgctgctactgctgctgctgctgcagctgttgctactgctgctgct
gcagctgttggctcggtcaacaacacgttcggtatccggggtgtcgaccagtactgcttc
tacttcaaatccattgaggacgcgggccggcttagggctcgagtgtccgagtgcttcgag
cgggcagcgctgcctgccaccccagaggaggaacgcaagaagctgctcacgtttgtggtg
gtgggcgggggccccacgggcgtcgaggtggcggcggagctgtacgacatgattgagtgc
gacctgtcgaagctttaccctaacattgtctcgattcaaattgtggagctgatggatcac
gtgctgtcaacgtacgacagggccatctccatttacactgccgagcagttcaagcgcgca
ggcatcaagctggttctaaacagccgggtggcggccgttgaggacggctgtgttcgggtg
gtcaacaaggccaacgaggttacggagataaagttcggagcctgtgtgtgggcgacgggt
attgcgatgaaccccctgatacggcaacttcaggagaagctgcctgggcagtcgcacttc
aggtcggtcctgactgacgagtgcctccgggtgaagggcagtgatggcagcatctgggcg
ttgggggatgcggccaccattgaccagcccaaggtgagtggctgggtagccaaccagcag
ggcaagtacctggccaaggtgttttcatccaccaagattacgggtaatccggagggaggg
gggttgagggtgagggtgagggcgagggcgagggcgagggggggctggtacttccacaag
ggctcggcggcctacgtgggcagtgacaaggccgtgttcgacctgccgcgtctcgggccc
ctcacgggcaccggagcgggcttcgtgtggaagagctacgagaccatgtcgcagttctcc
ttccgcaaccagtgcctggtggcggcggactggctgcgcaccaagatatttggacgggat
atctccagagtgtga

DBGET integrated database retrieval system