KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_78933Help
Entry
VOLCADRAFT_78933  CDS       T01330                                 

Gene name
hsp70H
Definition
(RefSeq) heat shock protein Hsp70H
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn03040  Spliceosome
vcn04141  Protein processing in endoplasmic reticulum
vcn04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    VOLCADRAFT_78933 (hsp70H)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    VOLCADRAFT_78933 (hsp70H)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    VOLCADRAFT_78933 (hsp70H)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vcn01009]
    VOLCADRAFT_78933 (hsp70H)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:vcn03041]
    VOLCADRAFT_78933 (hsp70H)
   03009 Ribosome biogenesis [BR:vcn03009]
    VOLCADRAFT_78933 (hsp70H)
   03110 Chaperones and folding catalysts [BR:vcn03110]
    VOLCADRAFT_78933 (hsp70H)
   04131 Membrane trafficking [BR:vcn04131]
    VOLCADRAFT_78933 (hsp70H)
   03051 Proteasome [BR:vcn03051]
    VOLCADRAFT_78933 (hsp70H)
   03029 Mitochondrial biogenesis [BR:vcn03029]
    VOLCADRAFT_78933 (hsp70H)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vcn04147]
    VOLCADRAFT_78933 (hsp70H)
Protein phosphatases and associated proteins [BR:vcn01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     VOLCADRAFT_78933 (hsp70H)
Spliceosome [BR:vcn03041]
 Complex B
  Other components
   Prp19 complex
    VOLCADRAFT_78933 (hsp70H)
 Complex C
   Prp19-CDC5 complex
    VOLCADRAFT_78933 (hsp70H)
Ribosome biogenesis [BR:vcn03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    VOLCADRAFT_78933 (hsp70H)
Chaperones and folding catalysts [BR:vcn03110]
 Heat shock proteins
  HSP70 / DNAK
   VOLCADRAFT_78933 (hsp70H)
Membrane trafficking [BR:vcn04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    VOLCADRAFT_78933 (hsp70H)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    VOLCADRAFT_78933 (hsp70H)
Proteasome [BR:vcn03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    VOLCADRAFT_78933 (hsp70H)
Mitochondrial biogenesis [BR:vcn03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    VOLCADRAFT_78933 (hsp70H)
Exosome [BR:vcn04147]
 Exosomal proteins
  Proteins found in most exosomes
   VOLCADRAFT_78933 (hsp70H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 FGGY_C
Motif
Other DBs
NCBI-GeneID: 9624257
NCBI-ProteinID: XP_002946253
JGI: 78933
UniProt: D8TII9
Position
Unknown
AA seq 618 aa AA seqDB search
MSVNITPAVGIDLGTTYSCVGVWQNDRVEIVANSQGNRTTPSYVAFTNTERLIGDAAKNQ
VAMNPHNTVFDAKRLIGRKFNDPVVQEDMKHWPFKVIQGPGDKVRGGRGGGSCSHPHPHP
HPHPLPLSNPSQAYLGPNSRVRQAVITVPAYFNDSQRQATKDAGTISGLEPCRTNKTKFV
GALQVSLLAIDEGIFEVKATSGDTHLGGEDFDNRMVAHFVQEFKRKNHGKDLSTSPRALR
RLRTACERAKRVLSSATQTTVELDSLYEGIDFYASITRARFEELCMDLFTKCVEPVEKVL
KDAQLDKSAIHDIVLVGGSTRIPKVQQLLQDFFHGRELCKSINPDEAVAYGAAVQAAILT
GTGGSKIQDLLLLDVTPLSLGIETAGGIMSVLITRNTTIPAHREEVFSTYSDNQPGVLIQ
VYEGERARTRDNNLLGKFELSGIPPAPRGVPKIKVSFDIDANGILHVSAEEQATGSSNRI
TITNDKGRLSAGEIKKMVEDAEKYAREDDQARKKVEARNKLEGFLYGIRNKLREPGAGDR
LTPEEKHTLDTTLDEALGWLERNQLAEVEEMEHKQREVEEALGTILSKVYGAGGSSGGAG
GGGGGAAGGGRPVVEEVD
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atgtcggttaacattacgccagcagttggcatcgacctcgggacaacctacagctgtgtg
ggcgtgtggcagaatgaccgcgtggaaatcgtggccaactcccaaggcaatcgcaccaca
ccctcctatgtggccttcaccaacacggagcggctcatcggcgatgctgccaagaaccag
gtggcgatgaacccgcacaacaccgtcttcgacgccaagcggctcatcggtcgtaagttc
aatgacccggtggtccaggaggacatgaaacactggccgtttaaagtcattcagggaccg
ggggataaggtgcgggggggaaggggtggtggttcatgctcccacccgcacccgcacccg
cacccgcacccccttccgctctccaacccaagccaggcctatttggggcccaacagccgt
gtacggcaggccgttattaccgtaccggcgtacttcaatgactcccagcgccaagccacg
aaggacgcgggcaccatctcggggctcgagccctgcagaacaaacaaaacgaagttcgtc
ggggcgctgcaggtgtcgctgctcgccattgacgagggcatattcgaggtgaaggccacc
agcggcgacacgcacctgggcggggaggactttgacaaccgcatggtcgcgcatttcgtc
caggaatttaaacgcaagaaccacggcaaggaccttagcaccagcccccgggccttacgc
cgcctccgtacggcatgtgagagggcaaagcgagtgctgtcctccgccacacaaaccacc
gtggagctcgacagtctgtacgagggtattgacttctacgcctccattacccgagcgcga
ttcgaggaactctgcatggacctcttcacgaagtgcgtggagcccgtggagaaggtgctg
aaggacgcgcagctggacaagtccgccatccacgatatcgtgttagtggggggctccact
cgcattcccaaggtacagcagctactacaggacttcttccacggcagggagctgtgcaag
tctatcaaccccgacgaagctgtagcgtacggcgctgccgtacaggccgccattttaact
ggcacgggtggtagcaagattcaagatctgcttctgctggacgtaactcctttgagtttg
ggcattgagacggcggggggcattatgtccgtcctgatcacccgcaacaccaccatcccg
gcacaccgggaggaggtcttctccacctattccgacaaccagccgggagtgctgattcag
gtgtacgagggcgaacgtgctcgtacacgcgacaacaatttgctgggcaagtttgagctc
agcggtatacctccggcgcctcgtggggtgcctaagattaaggtgtcgttcgatattgac
gccaacgggattttgcacgtgtccgcggaggagcaggccaccggctcgtccaatcgcatc
accatcacaaacgacaagggccgcctctccgcgggcgaaatcaaaaagatggtggaggac
gcggagaagtacgcccgagaggatgatcaagcccgcaaaaaggtggaggcacgcaacaag
ctggaggggttcctgtacggcatccgtaataagctacgcgagcccggtgctggcgaccgc
ctcacgccggaggagaagcacacgttggacacgacgctggacgaggccctagggtggctg
gaacgtaatcagttggcggaggtggaggagatggagcacaagcagcgagaggtggaggag
gcactgggcaccatcctgtccaaggtgtacggcgccggtggcagtagcgggggtgcaggt
ggtgggggtgggggcgccgcgggtggcggccggcctgtggttgaggaggtagattaa

DBGET integrated database retrieval system