KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_79498Help
Entry
VOLCADRAFT_79498  CDS       T01330                                 

Definition
(RefSeq) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00010  Glycolysis / Gluconeogenesis
vcn00020  Citrate cycle (TCA cycle)
vcn00620  Pyruvate metabolism
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
vcn01200  Carbon metabolism
Module
vcn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VOLCADRAFT_79498
   00020 Citrate cycle (TCA cycle)
    VOLCADRAFT_79498
   00620 Pyruvate metabolism
    VOLCADRAFT_79498
Enzymes [BR:vcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     VOLCADRAFT_79498
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 9620204
NCBI-ProteinID: XP_002947241
JGI: 79498
UniProt: D8TL92
Position
Unknown
AA seq 613 aa AA seqDB search
MSSGAQRLVLKIARAATTESNLTWATVGRLPWLSSASHARFLASYPAHVVLNMPSLSPTM
TQGNITKWRKQPGEQVAPGQILAEVETDKATIEWEAQEEGFMAKHLVPEGTQDIAVGTPV
AVLAEEAGDVAGLASFSPGASSPATPVAAASQPATSELPKSTHLPPHQVLNMPALSPTMS
QGNIVEWKKKVGDPVAPGDVYCEVETDKATISWESQEEGFVARILLPDGAKDIEVGRPAL
VLVDDKETVPFFASFTASDAASGEQTPPAPAAATATAAKAEVPPASAVSVQRPPETGETN
VAAPAAASTGRLRASPYARKLAAELGVALEALSGTGSVGRIVADDVRGATGSAAAIPPVA
APAAVSSATPQADTAAAYVDLPHNQIRRVVARRLLESKQTVPHYYLTMECRVEEIQQLRE
RLNALNSAGQKGGKGGAVAPKLSVNDFVVKAAAKALKEVPGVNASWFPDFIRQYNNVDIS
IAVQTPSGLQVPIVRNADLKSLGAISSEIRALAGKAKEGKLLPGDYAGGTFTVSNLGMYG
IKQFAAIVNPPQAAILAVGAMTPTIARVDGVFKEVPTILATLSCDHRVIDGAMGAEWLVA
FKAQIENPLLLFA
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccggagctcagcgactcgtgctaaagatagcccgggcagcaacaacagaaagc
aatctaacatgggctactgtcggtcgcctgccgtggttatcaagcgcaagccatgcacgc
tttctcgcttcataccctgctcacgtggtgctcaacatgccatcactctcgccgacgatg
actcagggaaacatcacgaagtggcggaagcaacctggtgaacaagttgcacctggacag
attctggcggaggttgagacggataaggctacgattgaatgggaagcccaagaagagggc
ttcatggcgaagcatctggtgccagaaggcacgcaggatattgctgtcggcacccctgtg
gcggtcctcgctgaggaagcaggggacgtcgcgggattggcatccttttctcccggagca
tcatcgcctgcaacaccggtagcagcagcatctcagcccgccacttcagagctgcctaag
tccacccatttaccgccacaccaggttctcaacatgcctgcgctttcacccactatgagc
cagggcaacatcgtcgaatggaagaaaaaggttggcgacccagtcgctcctggcgacgtg
tattgtgaggttgaaactgataaggctacaatttcatgggaaagccaggaagaaggcttc
gtggcccgcatactgctgccggatggtgcaaaggacatcgaggtgggacgaccagcgctg
gtgcttgttgacgacaaggagacagtccctttctttgccagttttacggcatcggacgca
gcttcgggagaacaaaccccccccgcgccggccgctgcaaccgccaccgctgcgaaggct
gaggtgccaccggccagtgctgtatcggtgcagaggccaccagagaccggagagacgaac
gttgcggctccggccgcggccagcacaggcaggctacgtgccagcccatacgcccggaag
ctggcagctgagttgggcgtggcgcttgaggcgctttctggcaccggttccgtggggcgc
atagtcgcagatgacgtgcgcggtgccactgggtcggcggctgccattccaccggttgca
gcgcccgccgctgtcagctcggccacgccacaagcagacacggccgcggcatatgttgac
ttgccgcataaccagatccggagagtggtggctcggcgtctgctggagagcaagcaaacg
gtgccgcactactacctcactatggagtgcagggttgaagaaatacagcagctccgggag
cgtttgaacgcactgaactcggcggggcaaaagggcggtaagggcggtgctgtggcaccc
aagttgagcgtcaacgacttcgtggtcaaggccgcagccaaggctctcaaggaagtgcca
ggcgtgaacgcaagctggtttcccgacttcattcgccagtacaacaacgtcgacattagc
attgcagtgcaaacaccatcaggcctgcaggtaccaatcgtgcggaatgcggatctcaag
agcctcggtgcaattagttccgagatccgtgctctggcagggaaggcaaaggagggcaag
ctgcttcctggggactacgcgggtggtaccttcacggtctcgaacctcggcatgtacggc
atcaaacagttcgccgctattgtcaatccaccacaggcggccatcttggcagtcggtgcc
atgacgcccaccattgcgcgcgttgatggtgtgttcaaggaggtgcctaccatcctggcg
acactcagctgcgaccaccgcgtaattgatggcgcaatgggcgcggagtggctagtggcg
ttcaaggcacagatcgaaaacccgttgttactgtttgcttga

DBGET integrated database retrieval system