KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_83109Help
Entry
VOLCADRAFT_83109  CDS       T01330                                 

Definition
(RefSeq) hypothetical protein
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00860  Porphyrin and chlorophyll metabolism
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
Module
vcn_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:vcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    VOLCADRAFT_83109
Enzymes [BR:vcn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     VOLCADRAFT_83109
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     VOLCADRAFT_83109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 FAD_binding_3 FAD_oxidored FAD_binding_2 DAO Thi4 HI0933_like
Motif
Other DBs
NCBI-GeneID: 9616217
NCBI-ProteinID: XP_002955194
JGI: 83109
UniProt: D8U992
Position
Unknown
AA seq 565 aa AA seqDB search
MLTSHATNIYANSKARLQIREIARPTVTGVSRSGVLQDVASPLPRQIPRPAQRAARPTSA
TATSSGVPTADSARGTKIVDNVYDVIVVGGGLSGLVTGQALSAQHGVNNFLVTEARERVG
GNITSMSGDGYVWEEGPNSFQPNDSMLQVAVDAGVEKDLVLGDPKAPRFVYWQNKLRPVP
SGPDALTFDLMSLPGKIRAGLGAIGLINGAMPNFEESVEQFIRRNLGDEVFERLIEPFCS
GVYAGDPSKLSMKAAFNRIWILEKDGSSLVGGALKLFQERRKNPPPPRDPRLPPKPKGQT
VGSFRLGLKMLPEAIERRIKDQVRVNWKLVSLTRDGDRYSLVYDTPEGRVQCYSRAVALT
APSYVVADLIKAEVPAAAEALSSFDYPPVGAVTLSYPLSAIRDDRKDAQGNVPGFGQLHP
RSQGVTTLGTIYSSSLFPGRAPPGHMLLLNYIGGATNRGIVNQTQEQLVAQVDKDLRLMV
LKPDAPAPRVVGVRVWPRAIPQFNIGHLELLDKARGALEAKGWNGVFLGGNYVSGVALGK
VVEYGYESAAKLAKHLTAAQKQVAV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgctgactagccatgccactaacatctacgcgaactcaaaggccaggcttcagatccgc
gagatcgctcggccgacggtgaccggtgtctcgaggtcaggcgttcttcaggatgtcgcc
tctccgctcccacggcagattccgaggccagctcaacgtgctgcgcgtcctacttctgct
acggccacttcaagtggggtacccacggcggacagtgcccgtggcacgaagatcgttgac
aatgtgtatgacgtgattgtggttggcggtggcctctccgggctcgttacgggtcaagcc
ctctcggcgcaacatggtgttaataacttcctcgttaccgaggctcgcgagcgcgtcggc
ggcaacattacgtccatgtcgggcgatggctacgtgtgggaggaaggcccaaacagcttc
cagccaaatgatagtatgttacaagtagctgtggatgccggggtggagaaggacctggtg
ttgggagaccccaaggcaccccgatttgtgtactggcagaacaagctccgtcccgtcccc
agcggccctgatgcgctcacctttgacctcatgtcccttccggggaagatccgagctggt
ctcggagccattggcctgatcaacggagccatgcctaactttgaggagagcgtggagcag
ttcatccgtcggaacctgggtgacgaggtgttcgagcgcctcattgagccgttctgctcg
ggggtgtacgcgggagatccatccaagctatccatgaaggcagcgtttaacaggatctgg
attttggagaaggacggcagcagtctggtggggggtgcgttgaagctgtttcaggagcgc
cgcaagaacccgccgccacctcgcgatccccgcctgccgcctaaacccaagggccaaacg
gtgggttctttccgtctcggtctcaagatgttgcccgaggcgattgagcggcgtatcaag
gaccaagtcagggtcaactggaagctggtgtcgttgacgcgcgacggcgatcgctacagc
ctggtgtacgacacgccggagggccgagtgcaatgctacagccgtgcggtggcgctgacg
gcaccgtcgtatgttgtggcggatcttatcaaggctgaggtgccagccgctgcggaggct
ctgtcctcgttcgactaccccccggtgggggccgtcactctgagctaccccctgtcagcc
atacgggatgatcggaaggacgcgcagggcaacgtgccgggtttcggacagctccacccc
cgctcgcagggcgtgacgactctgggcaccatctacagctcctccctgttcccgggtcgg
gctcccccggggcacatgctgctgctcaactacatcggaggggccacgaaccgagggata
gtcaaccagacgcaagagcagcttgtggcgcaggtggacaaggacttgcggttgatggtg
ctcaagcccgacgcgccggctccacgtgtggtgggcgtgcgggtttggccccgtgccatt
ccccagttcaacatcgggcacttggagctgctggataaggcccggggggcgctggaggcc
aagggctggaatggcgtcttccttggcgggaactacgtctcgggggttgccttgggcaag
gtggtggagtacgggtacgagagcgcggccaaacttgcaaagcacctcacagccgctcag
aagcaggtggcggtgtaa

DBGET integrated database retrieval system