KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_84321Help
Entry
VOLCADRAFT_84321  CDS       T01330                                 

Gene name
splh3
Definition
(RefSeq) DEAH-box nuclear pre-mRNA splicing factor
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    VOLCADRAFT_84321 (splh3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:vcn03041]
    VOLCADRAFT_84321 (splh3)
Enzymes [BR:vcn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     VOLCADRAFT_84321 (splh3)
Spliceosome [BR:vcn03041]
 Complex C
  Other components
   Step II factors
    VOLCADRAFT_84321 (splh3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C DEAD AAA_22 T2SSE AAA_19 DUF2075 AAA_30 ABC_tran AAA_33 AAA_16 PhoH NACHT Helicase_RecD AAA_24 SRP54 Flavi_DEAD TrwB_AAD_bind ATPase_2
Motif
Other DBs
NCBI-GeneID: 9623183
NCBI-ProteinID: XP_002958086
JGI: 84321
UniProt: D8UHF7
Position
Unknown
AA seq 754 aa AA seqDB search
MSNTGSLPIRIFSKDILAAVKNNDVIVVIGETGSGKTTQLSQILYEAGYASDGMIAVTQP
RRVGAVTVAKRVAEERGVQLGREVGYAVRFEDCSSSATRIKYLTDGTLLRECLEDPQLKR
YSIIVLDEAHERSLNTDILFGLLKRLVRSRNTQRAKEGETEAGSSSSRARRLKLVITSAT
LDGEKFSAYFGNCPVFNVPGRCFPVDIIHTLEDHLSDYVSAAIDTVMQIHTSQPDGDILM
FLTGQAEIEKAIGRIHQAVASLPAGSAGPLVVLPLYASLPPELQVRVFRPAPEGTRRCIV
ATNVAETSITVEGVVYVVDPGVVKQKSYQPASGMDSLDVVAISRVQATQRAGRAGRTKPG
KCFRLYTRTYYEHKMPNVTAPEIQRSSLVGTVLYLKSLQLEVDVLNFDFLDPPAVGALED
ALRQLLVLDALDSDGNVTPLGLRMSGLPLEPALARALLAARELGCVREMISVAAMLSSEH
VFLAGQGPGDVAAGDHPHGQDSRRYVGLGDHVLLLRLWEGWEAAGCSREFAREYGLDLRG
LNFARDIRRQLDGRQQRPSSPQCRWGGGTAPGAARASAAQVDALRHVLTIGFANKLARRL
PRHNGYKTLHAVSGQLAQLHPSCAQLREDADGLLPEFLVYHELVATSRPFLRQVCPSRAE
WVADVLPKIMSADVRRLSQGSSRGLGGAAGSGQPRSPGGGDGGGGGDRGGAGGPQEGPEA
RRNDDKAVDAARARYLARKQQQPPQPVGKSGHKR
NT seq 2265 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaatactggctccttgcccattaggatattttcaaaagacatattagcagctgtt
aaaaataacgatgttattgtagttatcggcgaaacaggttctggcaagaccacgcagctg
tcgcagatcctatatgaagccggctatgcatccgacggtatgatcgccgtcacgcagcca
cgccgcgtgggcgcagtcaccgtagcgaagcgcgtggctgaggagcgtggagttcagctg
ggtcgggaggtgggctatgcggtgcggttcgaggactgctcgtcgtctgccacacgcatt
aagtacctgaccgacggcaccttgctgagggagtgcctggaggacccccagctaaagcgc
tattcgatcatcgtgttggatgaggctcacgaacgctccctcaacaccgacatccttttc
ggactgctcaagcgcctggtgcgcagccgcaacacacaacgggccaaggaaggggaaacg
gaggcaggcagcagcagcagcagggcgaggcggctaaagctggtcattacttccgccacg
ttggatggggagaagttctctgcctattttggcaactgcccggtattcaacgtgcctggt
cgatgcttcccggtggacatcatccacacgttggaggatcacctgagcgactacgtgtca
gccgccatcgacacggtgatgcaaatacacaccagtcagccggacggcgatatcctgatg
ttcctgacggggcaggcggagatcgagaaggccatcggccgcatccaccaggcggtggcc
tccttgccggccggcagtgcggggccgctggtggtgctgccgctgtatgccagtctgccg
ccggagctgcaggtccgtgtgtttcgccccgctcccgagggcacccggaggtgtattgtg
gcgaccaatgtggcagagacgtccatcacagtggagggcgttgtctacgtggtggacccg
ggagtggtgaagcagaagagctaccagcccgcatccggaatggacagtctagacgtggtg
gcgatatcccgggtgcaggccacgcagagggcgggcagggcgggcaggaccaagccgggc
aagtgcttccggctgtacacccggacctattacgagcacaagatgcccaatgtgaccgcc
cccgagatccagcggtcctctcttgtggggacggtgctgtacctcaagtcgctgcagctg
gaggtagatgtgctcaacttcgacttcctggacccccctgcggttggggcgctggaggac
gctctgcggcagctgctggtccttgacgccctggacagtgacggcaatgtcacccctctg
ggcctccggatgtcggggctgcctctggagccggcactggcccgggcactgctggcggcc
agggaactgggatgcgttcgggagatgatcagcgttgcggccatgctctcatccgagcat
gtgttcctggcgggccaagggcccggggatgtggcagcaggggaccacccgcatgggcag
gacagccgcaggtatgttggacttggggaccacgtgctgctgctgcggctgtgggagggc
tgggaggcggcgggctgtagcagggagttcgcccgggagtacggactggacctgaggggg
ctcaacttcgcccgcgacattcgccgacagctggacgggcggcagcagcggccgtcttcc
ccccagtgccgctggggtgggggaacggctcctggggcggcccgggcgagtgcagcgcag
gtggacgccctgcggcacgtcctgaccattgggttcgccaacaagctcgcccggcgtctc
ccccgccacaacggctacaagaccttgcacgcggtgagcggccagctcgcccagctgcac
cccagctgcgcccagctgcgggaggacgccgacgggctgctgcccgagttcctcgtgtac
cacgagctggtggccacctctagacccttcctcagacaggtatgcccctcgcgtgctgag
tgggtggcggacgtgcttcccaagattatgtccgcggatgtacggcggctgagtcagggc
tccagccgggggttggggggagctgctggttcggggcagccgcgttcacccgggggtggg
gatggtgggggtggtggcgaccgggggggagcagggggaccccaggagggcccggaggcg
cggcgcaacgatgacaaggccgtggatgcagcccgagccaggtacctggcacgtaagcaa
cagcagccgccgcagcctgttggcaagtcagggcacaagcgatga

DBGET integrated database retrieval system