KEGG   Volvox carteri f. nagariensis: VOLCADRAFT_96572Help
Entry
VOLCADRAFT_96572  CDS       T01330                                 

Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
vcn  Volvox carteri f. nagariensis
Pathway
vcn00630  Glyoxylate and dicarboxylate metabolism
vcn00710  Carbon fixation in photosynthetic organisms
vcn01100  Metabolic pathways
vcn01110  Biosynthesis of secondary metabolites
vcn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vcn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    VOLCADRAFT_96572
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    VOLCADRAFT_96572
Enzymes [BR:vcn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     VOLCADRAFT_96572
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-GeneID: 9626476
NCBI-ProteinID: XP_002955677
JGI: 96572
UniProt: A0A125YYX7
Position
Unknown
AA seq 185 aa AA seqDB search
MAAIVAKSSVAAVVARPARSSVRPVAGLKPAVKAAPVAAPAQANKMMVWTPVNNKMFETF
SYLPPLTDEQIAAQVDYIVANGWIPCLEFAEADKAYVSNESTVRFGPVSCLYYDNRYWTM
WKLPMFGCRDPMQVLREIVACTKAFPDAYVRLVAFDNVKQVQIMGFLVQRPKSARDWQPA
NKRSV
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggccgctattgttgctaagtcgtctgtggccgccgttgttgcgcgccccgcccgcagc
agcgtgcgcccagttgccggtctgaagccggctgttaaggctgccccggttgctgctcca
gcccaggctaacaagatgatggtctggaccccggtgaacaacaagatgttcgagaccttc
tcctaccttccgcctctgacagacgagcagattgctgcccaggttgactacatcgtcgcc
aacggctggattccttgccttgagttcgctgaggctgacaaggcctacgtctcgaacgag
tcgaccgtccgcttcggcccagtctcctgcctgtactacgacaaccgctactggacgatg
tggaagctgcccatgttcggctgccgcgacccgatgcaggtgctgcgcgagattgttgcc
tgcaccaaggccttcccggacgcctacgtgcgcctggtggccttcgacaacgtgaagcag
gtgcagatcatgggcttcctggtgcagcgccccaagagcgcccgcgactggcagccggcc
aacaagcgctccgtctaa

DBGET integrated database retrieval system