KEGG   Vibrio cholerae O1 O395: VC0395_0020
Entry
VC0395_0020       CDS       T00520                                 
Name
(GenBank) sigma-54 dependent transcriptional regulator
  KO
K11908  sigma-54 dependent transcriptional regulator
Organism
vco  Vibrio cholerae O1 O395
Brite
KEGG Orthology (KO) [BR:vco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vco03000]
    VC0395_0020
Transcription factors [BR:vco03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    VC0395_0020
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 AAA_5 HTH_8 Mg_chelatase AAA_2 AAA DUF2381 AAA_16 TIP49
Other DBs
NCBI-ProteinID: ABQ18597
UniProt: A0A0H3AFG8
Position
1:complement(22315..23907)
AA seq 530 aa
MSQWLAFATQLVGVRKSHQLALQFVDLLTQGLDLSDSLLLLPSSDGRLLVPHDPQRQFAW
SVTDFDVPFAHVLQSSNAMHLTAEELVFWQSNRTFSQLTSRVGMFDSVWIQPLPMDTRQV
HSILLLMGESHGIVSAFENADFLKFIEVFSQQWSLLNDMEREEQRRLELKQSLTDIERDS
AQRSLANALSRTLIGESAAMQKLREQIVSAANSQLSVMVQGETGTGKELVAAAVHELSSR
KSAPFVAINCAAIPEHLLESELFGYCKGAFSGADSDKQGLIAQANGGTLFLDEIGDMPLT
LQAKLLRVLESRTFRPLGGKQELSSDFRLVSATHVNLLDQVRKKEFRQDLYYRLFQYPIT
LPRLAARLEDIELLSEHFVRVFNLQHNTRIRGLNYRAIDCLKQYDFPGNVRELKHLIEFG
CAQTADGTQVEASCFAHRLQTLPCLAPEATPVAVSVETENVDLEPSVALAGEPNFAVIHD
LKQAVSQFEALIISERLNRFAGDRAKAAKSLGIPKRTLAYKCLKLEIKTP
NT seq 1593 nt   +upstreamnt  +downstreamnt
atgagtcaatggctggcgtttgcaacccaattggtgggagtaaggaagtcccaccagctt
gcgctgcaatttgttgatctgctgactcaaggcttagatctgagtgatagccttttgttg
ttgccatcgtcggatgggcgtttacttgtgcctcatgatccacagcgtcagttcgcgtgg
tcagtgacggattttgatgtgccttttgcccatgttttgcagtcatccaatgcgatgcat
ttgaccgcggaagagttggtattttggcaatccaatcgcacttttagccagttaacctct
cgcgtggggatgtttgattcggtatggatccaacccctgccgatggatactcgtcaagta
cactcgatcttgctgttgatgggcgagagtcacggtatcgtgagcgcttttgaaaacgcg
gactttttgaagtttatcgaggttttttcccagcaatggtcactgctcaacgatatggaa
cgtgaagagcagcgccgcttggagctgaaacaatcgctgacggatattgaacgcgactcg
gcgcagcgctcactggccaatgcgttatcgcgtactttgattggtgaaagcgctgcgatg
caaaagctgcgtgagcagattgtctctgccgctaactctcagctctcggtcatggtgcaa
ggtgaaactggcacggggaaagagttagtcgccgcggccgtgcatgaactttcgtcacgt
aagtctgcgccgtttgttgcgatcaactgtgcggcgatccctgagcatctactggaaagt
gaactgtttggttactgcaaaggggcattttctggagcggacagcgataaacagggactt
atcgcacaagcgaatggtggcacgctatttctggatgagatcggcgatatgccgctcacc
ttacaagccaaattattgcgtgtgcttgaatcgcgtacttttcgaccgctcggtggtaag
caggagctcagttccgatttccgtctggtatctgccacacacgtcaatctgctggatcaa
gtacgcaaaaaagaatttcgccaagatctctattaccgtctattccagtatccgatcacc
ttgccgcgtttggcggcacgcttggaagatattgagctgctcagtgagcactttgtgcgc
gtgttcaacttgcaacataacacgcgcattcgtggtttgaactatcgagccatcgactgc
cttaagcagtacgacttcccgggaaatgtgcgtgagctgaaacatttgattgagtttggc
tgcgcgcaaacagcggatggtacgcaggtggaagctagttgctttgcccatcgtttacaa
accctaccctgtcttgcgcctgaagcgacgccggtagccgtttctgtcgaaactgagaac
gtggatcttgaaccctcggttgcgctggctggagaaccgaattttgcggttatccatgat
ttgaaacaggcggtcagtcagtttgaagcgttgatcatcagtgagcgtttgaaccgcttt
gctggcgatcgcgcgaaagcggcgaaaagtctcggtatccctaagcgtaccttggcctac
aagtgcctgaaattggagatcaaaaccccatga

DBGET integrated database retrieval system