KEGG   Vibrio cholerae O1 O395: VC0395_0022
Entry
VC0395_0022       CDS       T00520                                 

Definition
(GenBank) hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
vco  Vibrio cholerae O1 O395
Pathway
vco03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VC0395_0022
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vco02044]
    VC0395_0022
Secretion system [BR:vco02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC0395_0022
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: ABQ18695
UniProt: A0A0H3ADB8
Structure
PDB: 
4V3I

Position
1:complement(26545..27318)
AA seq 257 aa
MSQSKKETPLASLLFDDVEKINHDQDYWFQLRGDNPNVLIDAATPLFGLSLRVRTLTECD
NIEQIYRQTIEEIKAIEIELTEQGYEHAILMAYRYILCAFLDESVMGTEWGASSLWAEHS
MLSRFHNETWGGEKVFTILSRLEGEPHRYQALLAFIYHCLILGFEGKYRVMEGGQAEREK
VISRLHQLLSSLEESEPQDLTRPTDHVVRAKYTLSRQMPVWSVFAGFIVLWVGLFLGYSY
VLHSKSSDVLNQLNQIL
NT seq 774 nt   +upstreamnt  +downstreamnt
atgtcacagagtaaaaaagagacgccattagccagtttgttgttcgacgatgtggaaaaa
attaaccacgaccaagactactggttccaattgcgtggggacaatccgaatgtgctgatt
gatgccgcgacacccttgtttgggctttctctgcgggttcgtaccctcaccgaatgcgac
aacattgaacagatctaccgtcagacgattgaagagatcaaagcgattgaaattgagttg
acggagcaaggttacgaacacgccattttgatggcctatcgctacatcttgtgcgccttt
ttggatgaatccgtgatgggaaccgagtggggcgcgtccagtttatgggccgagcactcc
atgctgtcacgcttccataatgaaacgtggggtggcgagaaagtgtttacgattttgagc
cgtcttgagggtgaaccacaccgttaccaagcgctattggcctttatttatcattgcctg
attttgggctttgaaggcaaataccgtgtgatggaagggggacaagctgagcgcgaaaaa
gtgatcagccgcctgcatcaactgctgagcagcttggaagagagcgagccacaagactta
acccgtccgaccgatcatgtggtgcgtgcgaaatataccctaagcagacagatgcctgtt
tggtctgtgtttgctggctttatcgtgctttgggtaggtctatttctcggctacagctat
gtactgcatagcaaatccagcgatgtgctcaatcaactcaatcaaatactttaa

DBGET integrated database retrieval system