KEGG   Vibrio cholerae O1 O395: VC0395_0025Help
Entry
VC0395_0025       CDS       T00520                                 

Definition
(GenBank) putative lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
vco  Vibrio cholerae O1 O395
Pathway
vco03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VC0395_0025
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vco02044]
    VC0395_0025
Secretion system [BR:vco02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC0395_0025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN LPAM_1
Motif
Other DBs
NCBI-ProteinID: ABQ18414
UniProt: A0A0H3AEY5
Position
1:complement(28664..29140)
Genome map
AA seq 158 aa AA seqDB search
MNKVLWMLFALTVLTACSSSDKYEPAKEPTKVTFSLVSDEGVNPNIWGEASPIEIQVFEL
KDDSMFMSSDYDQIKTDYKKALRSNFVKNYDYVLTPGQFKFVNAFEVDEETNYIGVMAHF
AEPELSEWKKAVKVINKGREYHLLMLFKDYDVKLDRVE
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaaagtgctgtggatgctgtttgccttgacggtgctgaccgcgtgcagttcgtcg
gataagtacgagcctgcgaaagagccgaccaaggtgacttttagcttagtcagcgatgaa
ggggtgaacccgaacatctggggtgaagcgtcaccgatagaaattcaagtttttgagcta
aaggatgactcgatgtttatgtcgtccgactacgaccagatcaaaaccgattataaaaaa
gcgctgcgcagtaactttgttaaaaactacgactatgtactgactccagggcagttcaaa
ttcgtcaacgctttcgaagtcgatgaggagaccaactacatcggcgtgatggctcatttt
gccgagcctgaactcagcgaatggaagaaagcggtcaaggtgatcaataaagggcgagag
tatcacttgctgatgctgtttaaagactacgatgtgaaattggatagggtggaataa

DBGET integrated database retrieval system