KEGG   Vibrio cholerae O1 O395: VC0395_0028Help
Entry
VC0395_0028       CDS       T00520                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
vco  Vibrio cholerae O1 O395
Brite
KEGG Orthology (KO) [BR:vco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vco02044]
    VC0395_0028
Secretion system [BR:vco02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC0395_0028
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: ABQ19085
UniProt: A0A0H3AGM9
Position
1:complement(31613..33382)
Genome map
AA seq 589 aa AA seqDB search
MTQDKYFREELAFLKEQGKEFTEIHPQLSRFLHGRTTDPDVERLLEGFAFLTARLREKVE
DEFPELTHSIINMLWPNYLRPIPSMSVVAFEPDKSVSEKQVIPRNTQLDSKPVFGTACHF
NTCRDVALYPMQCQGVHAEHTREATTIQISLRMLGDMTVGDAKLDTVRFYLGGDKYSSQT
LYLWLHHYLQKMTIEVQGVEFALPADAFSTVGFSSDQALLPYPKNVYDGYRILQEYLSFP
EAFHFFDVKGFAKALPKAVSGDFTLRIHFSKTLPADTRVRQDNFQLYCTPVINLFEHDAD
PIDLTGRRSEYRIVPSSRYPAHYEIFSVDQVVGWQDTQSEGKRIRGEKRIYSSFESFQHE
VERVRHRQALYYRTRVKESIRGDGFDSFISFVRGDETLSMGVDEAVSIKLTCTNRLLPLE
LGVGDICVATDSSPPFATFKNITVPSQSLRPVLDGSLLWTLISNLSLNYLSLLSKDALSC
VLRAYDFRALVDRQAERVARMRLDGIVKIESKPVDKILRGLPVRGLQSTLYVDQAGFGSE
GDLFLFGTVLSHFFALYASINSFHELVVVNISNQEKYSWGTQSGMQPLI
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaagacaagtatttcagggaagagctcgcttttttaaaagagcaggggaaagaa
tttaccgaaattcaccctcagctttcgcgttttcttcatggccgtacgaccgatcctgac
gttgagcgtcttttggaaggttttgcatttcttaccgcgcgtttgcgcgaaaaggtggag
gatgagttccctgaacttactcactccatcattaacatgctgtggccaaattatctgcgc
cctatcccgagcatgagtgtggtggcgtttgaacctgacaaaagtgtcagcgagaagcaa
gtcatcccacgtaatacccaattggatagcaagccagtctttggcacggcgtgtcatttc
aacacttgccgtgatgtcgcgctatatccgatgcagtgtcaaggtgttcatgccgagcac
acacgtgaagccacgaccattcagatctcgttgcgcatgttgggcgatatgacagtaggc
gacgctaagctcgataccgtacgtttttacttaggtggtgataaatacagctcgcaaact
ctctatctttggttacaccattatctacaaaaaatgacgattgaagtgcagggtgtcgag
ttcgcactgcctgctgatgcgttttcaaccgtcggtttctcaagtgaccaagctttgctg
ccttatccaaagaatgtctatgacggttatcgtattttgcaagagtacctgtcgtttcct
gaagcctttcacttctttgatgtaaaaggttttgccaaagctttaccgaaagcggtcagc
ggtgatttcaccttacgcatccatttttcgaaaacattgcctgctgatacgcgagtgcgt
caggacaattttcaactctattgcacaccggtcatcaatctgtttgagcatgatgccgat
ccgatcgatttgactgggcgtcgttcagagtatcgaatcgtcccgtccagtcgctatcct
gcccactatgaaattttcagcgtggatcaagtggttggttggcaagatacccagtcagaa
ggcaaacggatccgcggagaaaagcgtatctactcttcttttgaaagcttccaacatgaa
gtggaacgggttcgtcatcgtcaagcgctttactatcgcacacgagtcaaagagagcatc
cggggggatggttttgattcatttatctcttttgtgcgcggtgatgaaaccttatcaatg
ggcgtagatgaagccgtctcaatcaaactcacctgcaccaatcgcttgctgccattggaa
cttggggtgggggatatttgtgtggcgaccgacagctcacccccttttgccacattcaaa
aatattacggtgccttcgcagtcactgcgcccggttctcgatggcagcttactgtggacg
ctgatctcgaatctatcgctgaactacctatcactgctctcaaaagatgcactgagctgt
gtgctacgcgcttacgattttcgcgccttggtcgataggcaagctgaacgtgtcgcacgg
atgcgccttgatggcatagtcaaaatagaatctaaaccggttgataaaatcctacgtggt
ttgcctgtgcgtggtttgcaatcgactttgtatgtcgatcaagcgggatttggctcggaa
ggtgatttgttcctgtttggtacggtactcagtcatttctttgcactttacgccagcatc
aactcatttcacgaattagtcgtggttaacatcagcaatcaagagaagtactcatggggc
acacagagcggaatgcagccgttgatctga

DBGET integrated database retrieval system