KEGG   Vibrio cholerae O1 O395: VC0395_0029
Entry
VC0395_0029       CDS       T00520                                 

Definition
(GenBank) hypothetical protein
  KO
K11905  type VI secretion system protein
Organism
vco  Vibrio cholerae O1 O395
Brite
KEGG Orthology (KO) [BR:vco00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vco02044]
    VC0395_0029
Secretion system [BR:vco02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC0395_0029
SSDB
Motif
Pfam: GPW_gp25
Other DBs
NCBI-ProteinID: ABQ18724
UniProt: A0A0H3ADE1
Position
1:complement(33388..33813)
AA seq 141 aa
MTYIAPEESAFGVGFFERLEANAKPMSLTRGPDAWDVLESIKRNVSNILNTRIGGAQSAP
HLGLVDFNDATLETLDLSVRIKLAIQQCLERYEPRLTRADQDSFNSLTLRFHITATINSE
ALHEKVQFSLLLDQSRKYRVF
NT seq 426 nt   +upstreamnt  +downstreamnt
atgacgtacatcgcacctgaagagagtgcatttggtgttggctttttcgaacgtttggaa
gccaacgccaaacctatgtcgctgacccgtgggccagacgcgtgggatgtactcgaatcg
atcaaacggaatgtctctaacattctgaacactcgaattggtggagcgcaaagtgcccct
catctcgggttggtggattttaatgatgcaacgctggaaaccttagatctctccgtgcga
attaaattggcgattcaacagtgccttgagcgctatgagccgcgtttaactcgagcggat
caagatagctttaactcgctgactttaaggttccacattaccgcgaccatcaatagcgaa
gcgttacacgaaaaagtccagttcagtctgttattggatcaaagcagaaaatatcgagtg
ttttaa

DBGET integrated database retrieval system