KEGG   Vibrio cholerae O1 O395: VC0395_0114
Entry
VC0395_0114       CDS       T00520                                 

Name
(GenBank) hypothetical protein
Organism
vco  Vibrio cholerae O1 O395
SSDB
Motif
Pfam: DUF4123
Other DBs
NCBI-ProteinID: ABQ18678
UniProt: A0A0H3AEJ8
Position
1:complement(129322..130209)
AA seq 295 aa
MRSTNSFVVHNWVSLVPEMEMDTQERLYLLVDGAQISHLAQALYRLSGELVLEPLYLFPP
FEQLKEVSPYLVLATDTVKTWFLEQNQGLAGFFFASLDSIEEIAEQLRRLIQVESPYGST
VFLKMANSECAYVLLSTQCQPLWKVINRAWLPTRQGWQYVQRPELTATQDTPVRFKLTDE
QWQRLGNITWLNTLETVERHVQQWFPDLAQQWQSDPELFHRHAQWAYQQGFSSERDLMLF
FNVLGFLGVDALEKGKYPEIDPLLHQASSRTPSQRIEAAAELAYQHSQSSQEVQG
NT seq 888 nt   +upstreamnt  +downstreamnt
atgcgttcaacaaattcctttgtcgtgcataactgggtgagcttggttccagagatggaa
atggatacacaagaaaggctttaccttttggttgatggtgctcaaatcagccatctagca
caagccttgtatcgtctatcgggtgaattggttttggagcctttgtacctttttccgcct
tttgagcagcttaaagaggtgtctccttatctcgtgttagcaacggatacggttaaaacc
tggttccttgagcagaatcaggggttagctgggttcttttttgcttctttagattctatt
gaagagattgctgaacaactgcgtcgtttgatccaagtggagtccccttatggttcaacg
gtgtttcttaaaatggcgaacagtgaatgcgcgtatgtacttttgagtacccaatgccaa
ccgctgtggaaagtgatcaatcgagcttggttgccgacacgtcaaggttggcaatatgtg
caacgacccgaactgacggcgactcaagacactcctgtgcgattcaagttaaccgatgag
cagtggcaacggcttggcaacatcacatggcttaataccttagaaacggtcgagcggcat
gtgcagcagtggttcccggatttagcgcagcagtggcagtctgaccctgaactatttcat
cgtcatgctcaatgggcttaccagcagggctttagcagtgagcgagatttaatgctgttt
tttaatgtgttggggtttttaggtgttgatgctcttgaaaaagggaagtatcccgagatt
gatcctttgttgcatcaggcttcaagtcgtacgccttcgcaacgcattgaagctgccgca
gagctggcttatcaacattcacaatcatcacaggaggtacaaggatga

DBGET integrated database retrieval system