KEGG   Vibrio cholerae O1 O395: VC0395_0630Help
Entry
VC0395_0630       CDS       T00520                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vco  Vibrio cholerae O1 O395
Pathway
vco00071  Fatty acid degradation
vco00280  Valine, leucine and isoleucine degradation
vco00310  Lysine degradation
vco00362  Benzoate degradation
vco00380  Tryptophan metabolism
vco00620  Pyruvate metabolism
vco00630  Glyoxylate and dicarboxylate metabolism
vco00640  Propanoate metabolism
vco00650  Butanoate metabolism
vco00900  Terpenoid backbone biosynthesis
vco01100  Metabolic pathways
vco01110  Biosynthesis of secondary metabolites
vco01120  Microbial metabolism in diverse environments
vco01130  Biosynthesis of antibiotics
vco01200  Carbon metabolism
vco01212  Fatty acid metabolism
vco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VC0395_0630
   00630 Glyoxylate and dicarboxylate metabolism
    VC0395_0630
   00640 Propanoate metabolism
    VC0395_0630
   00650 Butanoate metabolism
    VC0395_0630
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VC0395_0630
   00072 Synthesis and degradation of ketone bodies
    VC0395_0630
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VC0395_0630
   00310 Lysine degradation
    VC0395_0630
   00380 Tryptophan metabolism
    VC0395_0630
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VC0395_0630
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VC0395_0630
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VC0395_0630
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vco04147]
    VC0395_0630
Enzymes [BR:vco01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VC0395_0630
Exosome [BR:vco04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VC0395_0630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABQ19457
UniProt: A0A0H3AGH0
Position
1:complement(688612..689817)
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQVKPEAVDEVIVGNVVSAG
QGMGVGRQAALVAGVPQSVPAYSINMVCGSGMKSVMDGVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKATAAIEAGHFKREIVPISVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLADQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatctatatcgtgggagcaaagcgctcagctatcggagcctttggtggttca
cttaaagagtgttcggcaggcgctttggcaggacaagtcatccaagccgctcttgaagcc
gcacaagtcaaacctgaagctgtcgatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagtggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtgggatgaaatcggtgatggatggggttgcg
cacatcaaagcgggagatgcttctgtcgttgtggccgctggtgttgaggtcatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggcgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaataccacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatcgctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgacagcggccattgaagccggacattttaagcgagaaatt
gtgcctatttcggtcaaaaaacgccgtgaaaccgtcgtgtttgatacggatgaataccct
aaaccgacgaccacgttggcagcattgcaaggcttacgcgccgccttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agcgaaagtgcggtaaaaaaactaggcttaacccctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagtcactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtttagctgatcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccactaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgtcgcttcactctgcgtcggcggtggcatgggcaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system