KEGG   Vibrio cholerae O1 O395: VC0395_A0085Help
Entry
VC0395_A0085      CDS       T00520                                 

Gene name
oadA-1
Definition
(GenBank) oxaloacetate decarboxylase, alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
vco  Vibrio cholerae O1 O395
Pathway
vco00620  Pyruvate metabolism
vco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VC0395_A0085 (oadA-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vco02000]
    VC0395_A0085 (oadA-1)
Enzymes [BR:vco01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     VC0395_A0085 (oadA-1)
Transporters [BR:vco02000]
 Other transporters
  Primary active transporters [TC:3]
   VC0395_A0085 (oadA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 PTS_EIIA_1 GCV_H
Motif
Other DBs
NCBI-ProteinID: ABQ20417
UniProt: A0A0H3AJ52
Position
2:73431..75224
Genome map
AA seq 597 aa AA seqDB search
MSMSKPLAITDVVLRDAHQSLFATRMRIEDMLPIAAELDKIGYWSLETWGGATFDACIRF
LGEDPWERLRALKKAMPNTPMQMLLRGQNLLGYRHYADDVVEKFVERAHVNGMDVFRIFD
AMNDVRNFEKAVKATIGVGAHAQGTLSYTTSPVHNTQTWVDLAKRLEDLGCHSLCIKDMS
GLLKPYEAEELITRIKQSCAVPLALHCHATTGLSTATAVKAVEAGIDILDTAISSMSQTY
GHTPTETVVAMLQDTPRDTQLKLEQLEPIAAYFREVRKKYAKFEGQLKGVDSRILIAQVP
GGMLTNMESQLKEQGAAHRIDEVLEEIPRVRQDLGFIPLVTPTSQIVGTQAVINVLTGER
YKSITKETAGVLKGEYGATPASVNAELQARVLEGGQAITCRPADLLQDELDHLTKELLEK
AQVEKITLADAKVDDVLTYALFPQVGLKFLKNRHNPEAFEPAPGKEPAPVATAPASTKPA
AGIESYSVKVDGVVYDVEVGSQGQLTSVVPAGQKAAPKLAVATPTQGAEAVAAPLAGTIF
KIQVEQGDEVAEGDVLIVLEAMKMETEIRAARSGVIQELHVKEGDSVRVGASLLSLA
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgtctaaaccattagccatcaccgatgtcgtcctacgtgacgcccaccaatcg
ctctttgctacgcgtatgcgtattgaagatatgctgccgatcgcggctgagctggataaa
atcggttactggtcgttggaaacttggggtggagcgacgtttgatgcttgcatccgtttc
cttggcgaagatccatgggaacgtctacgcgctttgaaaaaagcgatgccgaatacccca
atgcagatgttactgcgcggccaaaacttactcggttatcgtcattacgcggatgatgtc
gtcgagaaatttgtcgagcgcgcccatgtcaatggcatggatgtattccgtatttttgat
gcgatgaacgatgtgcgcaattttgaaaaagcggtaaaagcgacgattggtgtgggcgct
catgcgcaaggaacactctcttacacgacgagccctgtgcacaacacgcaaacttgggtg
gatttagcaaaacgtcttgaagatctcggctgccactctttatgtatcaaagacatgtcg
ggtctgctcaaaccttatgaggccgaagagttaatcacgcgtattaagcagtcttgcgcg
gtgcctttggcgctgcattgtcacgcgacaacaggtttatctacggctacggcagtcaaa
gcggtggaagcggggattgatattcttgataccgcgatttcctcaatgagccagacttat
ggccatacgcccacggaaaccgtggtcgctatgctgcaggatacaccacgtgatacacaa
ctcaaattggagcaacttgaaccgatcgcggcttacttccgtgaggttcgtaaaaaatac
gccaagtttgaaggtcagttaaaaggtgttgattcgcgcattctgattgctcaggtgccc
ggcggcatgctgaccaatatggaaagccagttgaaagagcaaggtgccgcgcaccgtatc
gatgaggtattggaagagatccctcgcgttcgtcaggatcttgggtttattccgttagtg
actcctacctcgcagattgtcggcactcaagcggtgatcaacgtgttaaccggtgagcgc
tataagagcattaccaaagaaaccgcaggcgttcttaaaggtgaatacggtgcaacgcct
gctagcgtgaatgctgagctgcaagcacgcgtattagaaggtggacaagcgattacttgt
cgtcctgctgatcttctgcaagatgaacttgaccatctcactaaagagctgcttgaaaaa
gcgcaagtagaaaaaatcaccttagcggatgcgaaggtcgatgatgttctgacttatgcg
ctgtttccacaagttggcctgaaattcctgaaaaatcgccataatccagaggcgtttgaa
cctgcgccgggcaaagagcccgctccggtggctaccgcccctgcgagcaccaaacctgca
gcaggtatcgagagctacagtgtgaaagtggacggcgtggtgtatgacgttgaagtgggt
tcacaaggtcaattgacctcagtggtacccgctggccaaaaagcagcaccaaaactggct
gttgcaacacccactcaaggcgcagaagcggttgctgcccctttggcggggaccatcttt
aaaatccaagttgaacaaggcgatgaagtggcagaaggtgatgtgcttatcgtgttagaa
gcgatgaagatggaaactgaaatccgtgcagcgcgcagtggtgtgattcaggaactgcat
gtcaaagaaggcgacagcgttcgcgttggcgcctcactgctgagcttggcataa

DBGET integrated database retrieval system