KEGG   Vibrio cholerae O1 O395: VC0395_A0344Help
Entry
VC0395_A0344      CDS       T00520                                 

Gene name
aldA-1
Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
vco  Vibrio cholerae O1 O395
Pathway
vco00010  Glycolysis / Gluconeogenesis
vco00053  Ascorbate and aldarate metabolism
vco00071  Fatty acid degradation
vco00280  Valine, leucine and isoleucine degradation
vco00310  Lysine degradation
vco00330  Arginine and proline metabolism
vco00340  Histidine metabolism
vco00380  Tryptophan metabolism
vco00410  beta-Alanine metabolism
vco00561  Glycerolipid metabolism
vco00620  Pyruvate metabolism
vco00625  Chloroalkane and chloroalkene degradation
vco00903  Limonene and pinene degradation
vco01100  Metabolic pathways
vco01110  Biosynthesis of secondary metabolites
vco01120  Microbial metabolism in diverse environments
vco01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:vco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VC0395_A0344 (aldA-1)
   00053 Ascorbate and aldarate metabolism
    VC0395_A0344 (aldA-1)
   00620 Pyruvate metabolism
    VC0395_A0344 (aldA-1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VC0395_A0344 (aldA-1)
   00561 Glycerolipid metabolism
    VC0395_A0344 (aldA-1)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VC0395_A0344 (aldA-1)
   00310 Lysine degradation
    VC0395_A0344 (aldA-1)
   00330 Arginine and proline metabolism
    VC0395_A0344 (aldA-1)
   00340 Histidine metabolism
    VC0395_A0344 (aldA-1)
   00380 Tryptophan metabolism
    VC0395_A0344 (aldA-1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VC0395_A0344 (aldA-1)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VC0395_A0344 (aldA-1)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VC0395_A0344 (aldA-1)
Enzymes [BR:vco01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     VC0395_A0344 (aldA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABQ21488
UniProt: A5F3A7
Position
2:complement(365996..367621)
Genome map
AA seq 541 aa AA seqDB search
MKFQYDFVFLNQFSCKKLISFYRIIFPSKKVAVFYMIYPIPNSETSTVHFKDVYDNYIGG
QWMKPHSGEYFSNTSPVNGLVFCRVARSSSQDVELALDAAHNALESWSTTSAVERSNILL
RIADRIESNLETLAIVESWDNGKPIRETLAADLPLTIDHFRYFAACIRSQEGAASELDSR
TLTYHLPEPIGVVGQIIPWNFPLLMAAWKLAPALAAGCTVVLKPAEQTPVSILFLMEIIG
DLIPAGVINVVNGFGSEAGNALATSQRIDKLAFTGSTEIGNHILKCAADNLIPSTIELGG
KSPNIYFPDIFSHEDQYLDKCIEGALLAFFNQGEVCTCPSRILVHESIYEKFIAKIIERV
ALIKQGNPLDTETQIGAQVSKEQYDKILGYIQIGKDEGAELIFGGHPNNQENYLSGGYYI
KPTLFFGHNQMHIFQEEIFGPVIAITKFKDEIEALHLANDTVYGLGAGVWTRDINIAHRM
AKNIKAGRVWVNCYHAYPAHAAFGGYKKSGIGRETHKLTLSHYQNIKNVLISHEIHPLGL
F
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
ttgaaatttcaatacgattttgtttttttaaatcaattctcatgtaagaagttaatttca
ttctatagaataatttttccatcaaaaaaggtagctgttttttatatgatttatccaatt
cctaatagcgaaacttcgactgttcatttcaaagatgtatatgataattacattggaggt
caatggatgaagccacacagtggcgaatattttagcaatacgtcaccagtaaatggactg
gtgttttgtcgtgttgctcgctcgtcttcgcaagatgtcgaacttgctctagatgccgcc
cataatgcacttgaatcatggtctacaacaagtgcagtagaaagatcaaatattcttctg
aggattgctgatcgaatcgaatcaaatttagaaactctcgcaatagttgaatcatgggat
aatggaaaacctatccgtgaaactttagcagctgacctaccgttgactattgatcacttt
cgatattttgcggcttgtattcgatcacaagaaggtgctgcttccgaacttgactctaga
acgttaacttatcatttaccggaaccaataggtgttgtaggccaaataataccatggaat
tttccgttactcatggctgcttggaaattagctcccgctcttgcagcaggttgtactgtt
gttctcaaacctgcagaacaaacccccgtttcaattttgtttttaatggaaattattggt
gatttaattccagctggtgttattaatgttgttaatggtttcggctctgaagcaggtaat
gcattagcaacaagccaacgtatcgataaactagcatttacaggttctactgaaattggt
aaccatattcttaaatgtgcggcggataacttgattccatccacaatcgaattaggtgga
aaatctccaaacatttatttccccgatatcttttctcatgaagaccaatatcttgataaa
tgtattgagggtgcacttttagcatttttcaaccaaggtgaggtttgtacctgtccatct
agaattttagttcatgaatctatttatgaaaaattcattgccaaaattattgaacgagta
gcattaattaaacaaggaaatcctttagataccgaaacacaaattggtgctcaagtatct
aaagaacagtacgataagattcttggttatatacaaataggtaaagatgaaggggcagag
ctaatttttggtgggcatcctaacaatcaagaaaattatttatctggtggttattatatt
aaaccaaccctattctttggtcataatcagatgcatatctttcaagaggaaatatttgga
cctgtaattgcaatcactaagtttaaagatgaaattgaagcactgcaccttgctaatgat
actgtttatggtttaggtgccggtgtgtggacacgtgatataaatattgctcatcgtatg
gcaaaaaacattaaagctggaagagtatgggtaaattgttatcatgcatatcctgctcat
gcggcttttggtggatataaaaaatctggcattggacgagaaacacacaaattaacattg
agtcattaccaaaatataaaaaacgttcttattagtcatgagattcatcctctaggtcta
ttttaa

DBGET integrated database retrieval system