KEGG   Vibrio cholerae O1 O395: VC0395_A0411Help
Entry
VC0395_A0411      CDS       T00520                                 

Definition
(GenBank) pseudouridine synthase Rlu family protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
vco  Vibrio cholerae O1 O395
Brite
KEGG Orthology (KO) [BR:vco00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vco03016]
    VC0395_A0411
Enzymes [BR:vco01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     VC0395_A0411
Transfer RNA biogenesis [BR:vco03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    VC0395_A0411
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ABQ20639
UniProt: A0A0H3AJC9
Position
2:437431..438165
Genome map
AA seq 244 aa AA seqDB search
MLEIVYQDEYLVAVNKPAGMLVHRSWLDKHETEFVMQTLRDQIGQHVFPLHRLDRPTSGV
LVFALSSQIASEVMPMFANHEMEKTYHAIVRGWIEEANVLDYPLKEELDKIADKFAKQDK
EAQSAVTAYRPLAKVELPIATGKFATTRYCLMEMQPKTGRKHQLRRHMAHLRHPIVGDTT
HGDGVHNRLFREHFSAQRLMLHASELRFMHPYTQQPLVIRAGLDEVWQGLLSEFGWQESL
LINA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagattgtttatcaagatgaatatttggtggcggtcaataaaccggctggcatg
ttggtgcaccgttcatggctcgacaagcatgaaaccgagtttgtgatgcagaccctgcgc
gatcaaattggtcagcacgttttcccgctacaccgtctggatcgcccgacatccggtgtg
ttggtgtttgcgctttcgagtcagattgcctctgaagtgatgccgatgtttgccaatcat
gagatggagaaaacctaccacgccattgtgcgcggctggattgaagaggcaaatgtgctc
gattatccactcaaagaagagctcgacaaaattgccgataaatttgccaagcaagataaa
gaagcgcagtcggcggtgacagcttatcggccactcgccaaagtggaactgcccattgct
acgggaaagtttgccactacccgctattgcttgatggagatgcaaccgaagaccgggcgc
aaacatcagctgcgtcgtcatatggcacatctgcgtcatccgatagtgggtgataccacc
catggcgatggagttcataaccgactgtttcgtgaacacttttccgcgcaacgtttgatg
ctgcatgccagcgagttacgttttatgcatccttatacccagcagccgttagtgattcgc
gctggactagatgaagtgtggcaaggcttgcttagtgagtttggttggcaagagtcgctg
ttaatcaacgcttga

DBGET integrated database retrieval system