KEGG   Vibrio cholerae O1 O395: VC0395_A1025
Entry
VC0395_A1025      CDS       T00520                                 

Gene name
hcp-2
Definition
(GenBank) hcp protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
vco  Vibrio cholerae O1 O395
Pathway
vco03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vco00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VC0395_A1025 (hcp-2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vco02044]
    VC0395_A1025 (hcp-2)
Secretion system [BR:vco02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC0395_A1025 (hcp-2)
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ABQ20818
UniProt: A0A0H3AJT9
Structure
PDB: 
5MXN

Position
2:1068101..1068619
AA seq 172 aa
MPTPCYISIEGQTQGLITAGACTADSIGDSFVEGHEDEMLVQQFDHVVTVPTDPQSGQPS
GQRVHKPFKFTVALNKAVPLLYNALSSGEKLKSVELKWYRTSIEGKQENFFTTKLENASI
VDIHCEMPHCQDPAKSDFTQNVTVSLSYRKITWDHVNAGTSGSDDWRKPIEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaactccatgttatatctctatcgaaggccaaactcagggtcttatcactgcaggt
gcatgtactgctgactctatcggcgattcattcgttgaaggccacgaagatgagatgctg
gttcagcagtttgaccacgttgtgactgtaccgactgacccacaatctggtcagccttca
ggccaacgtgtgcacaagccattcaaattcactgtggcgctgaacaaagcggttcctctg
ctgtacaacgcgctctcttctggtgagaagctgaagtcggttgagctgaagtggtaccgt
acctctatcgaaggtaaacaagagaacttcttcaccactaagctggaaaacgcgtctatc
gtcgacatccactgtgaaatgccacactgccaagacccagcaaaatctgactttactcag
aatgtgactgtgtctctgtcttaccgcaaaatcacttgggaccacgttaacgcgggcacc
tcaggctctgatgactggcgtaagccaatcgaagcgtaa

DBGET integrated database retrieval system