KEGG   Vibrio cholerae O1 O395: VC0395_A1057
Entry
VC0395_A1057      CDS       T00520                                 

Gene name
rtxD
Definition
(GenBank) RTX toxin transporter
  KO
K12532  membrane fusion protein, RTX toxin transport system
Organism
vco  Vibrio cholerae O1 O395
Pathway
vco02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vco00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VC0395_A1057 (rtxD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vco02000]
    VC0395_A1057 (rtxD)
   02044 Secretion system [BR:vco02044]
    VC0395_A1057 (rtxD)
Transporters [BR:vco02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   VC0395_A1057 (rtxD)
Secretion system [BR:vco02044]
 Type I secretion system
  RTX toxin transporter
   VC0395_A1057 (rtxD)
SSDB
Motif
Pfam: HlyD_3 HlyD HlyD_D23 Biotin_lipoyl_2 QRPTase_N
Other DBs
NCBI-ProteinID: ABQ21019
UniProt: A0A0H3AK72
Position
2:complement(1103802..1105205)
AA seq 467 aa
MAASARAQTRGSLRMNTIMKRFFGQKSPHQPTEHHYEFLPAHLALAQRPPSPFARVTALT
LSLGVLAALLWAYWGKLDVQATATGRLVVSGRSQVIQSYEQSRLLSIHVRDGQRVEKGAP
LLTLDTLGVNQDITRLVSQAEFQTNELIRYRTLLNDQLLTHDPMFTALPAEQQALIHENY
LSEKNEFDSTLASITAEMKVNRTSQAARQSDIHALLQLTENISQRLAARKKLNQVKVIGH
VEYLEQEKELLEAQRQVAQQRAELEVLKSQYESLEERLTGFKAQKQREWLEKRRQARLQL
ASLNQELSKVREREQLEIIRSPVDGTVQQLSVYTLGAVLQPAQNLMIIVPENRVQQAEVQ
ILNKDVGFVYPGQSVTVKVDAFPYTRYGTIDAELLSISRDSTTDEQLGLVFPAQIQLKTN
HIMIDGQTVELTPGMSVVAEIKTDKRRVIDYLLSPIQEYQAEALRER
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggcagcttcagcaagagctcaaacaagaggaagcctccgcatgaacaccatcatgaag
cgtttctttggtcaaaagtcaccacatcaacccacagaacatcactatgagtttttgccc
gcacatcttgctttggctcagcgtcctccctcgccttttgctcgcgtgactgcgcttacg
ctcagcttaggtgtgctcgcagccttgctctgggcgtattggggaaaattagatgtacag
gccaccgccactggccgccttgttgtatctgggcgttcgcaagtgattcagtcttatgag
caaagccgactgttaagcatccacgtcagagatggtcaacgagttgaaaaaggcgcccca
ttgctgactcttgataccttgggcgtcaatcaagatattacgcgtttggtcagccaagca
gagtttcaaacgaacgagttgatccgctatcgcaccttgcttaatgaccagctcttgact
catgacccaatgtttaccgctctaccagccgaacaacaagctttgatccatgaaaactat
ctcagcgaaaaaaacgaattcgactcaacgctggcaagcatcaccgccgagatgaaggtg
aaccgcacgtcgcaggccgcgcgccaaagcgatatccatgcgttgttgcagctcacagaa
aacatcagtcagcgccttgctgcccgcaaaaagctcaaccaagtcaaagtgatcggtcat
gtcgagtatcttgaacaagaaaaagagctgctcgaagcgcagcgccaagtggcccaacag
cgagccgagctggaagtgcttaaatcgcaatatgaaagccttgaagagcggctaacgggc
ttcaaagcgcaaaagcagcgagagtggttggaaaagcgcagacaggccagattgcaattg
gcttctttaaatcaagaactttctaaggttcgtgagcgtgagcaactcgaaatcatccgc
tcgcccgttgacggcactgtgcaacagttgagtgtctatacccttggggcagtactgcaa
ccggcacaaaacttgatgatcattgtgcctgagaaccgtgtgcaacaggcagaagtgcaa
attctcaataaagatgtcggtttcgtgtacccaggccaatcggtcacggtcaaagtcgat
gccttcccctacacacgatacggcacaatcgatgccgagctactcagtatctcgcgagac
tcaacaacagatgaacagttagggctggtgttccctgctcaaattcagctaaaaaccaac
catattatgattgatggacaaacggtcgaactcactcccggcatgtcggtcgtcgcggaa
atcaaaaccgataaacgacgtgtgattgactatctgcttagcccgattcaggaataccaa
gctgaagcgttgagggagagatag

DBGET integrated database retrieval system