KEGG   Vibrio cholerae O395: VC0395_A1734Help
Entry
VC0395_A1734      CDS       T00520                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
vco  Vibrio cholerae O395
Pathway
vco00300  Lysine biosynthesis
vco01100  Metabolic pathways
vco01120  Microbial metabolism in diverse environments
vco01230  Biosynthesis of amino acids
Module
vco_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    VC0395_A1734 (dapE)
Enzymes [BR:vco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     VC0395_A1734 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ABQ20631
UniProt: A5F6B5
Structure
PDB: 

Position
2:1856356..1857489
Genome map
AA seq 377 aa AA seqDB search
MTDSPVLALAKELISRQSVTPADAGCQDLMIERLKALGFEIESMVFEDTTNFWARRGTQS
PLFVFAGHTDVVPAGPLSQWHTPPFEPTVIDGFLHGRGAADMKGSLACMIVAVERFIAEH
PDHQGSIGFLITSDEEGPFINGTVRVVETLMARNELIDMCIVGEPSSTLAVGDVVKNGRR
GSITGDLKVKGTQGHVAYPHLANNPVHKALPALAELAATQWDEGNAYFPPTSFQIPNLQA
GTGASNVIPGEFDVQFNFRFSTELTDEEIKRRVHSVLDAHGLDYGVKWTLSGQPFLTDTG
ELLAAVVAAVEEVNHQAPALLTTGGTSDGRFIAQMGAQVVELGPVNATIHKVNECVRIAD
LEKLTDMYQKTLNHLLG
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgacagatagccctgtactggctctggcaaaagagctgattagccgccaatccgttact
cctgccgacgcaggatgtcaggatctgatgattgagcgcttaaaagcgctgggtttcgaa
attgaaagcatggtgtttgaagacaccaccaacttctgggctcgccgcggcacgcaatct
cccctgtttgtttttgcaggtcataccgatgtggtgcctgccggccctttgtcgcagtgg
cacactcctccttttgagccgactgtgattgatggtttcctgcatgggcgtggcgcagca
gatatgaaaggctcgctggcttgtatgattgtggcggtagagcgttttattgccgaacat
cccgatcatcaaggctcaatcggttttttgatcacttctgatgaagaaggcccctttatc
aacggtaccgtccgtgtcgtagaaacgctaatggcacgtaacgaactgatcgatatgtgt
atcgtcggtgagccgtccagtaccctagccgtaggcgatgtggtgaaaaatggccgtcgt
ggctccatcacgggggatttgaaggtaaaaggcactcaaggccatgttgcttatccgcat
ctggctaataatcccgtgcataaagcgctccccgcattggccgaactcgccgccacccaa
tgggatgaaggtaacgcctatttcccccccaccagctttcaaattcctaacctgcaagcg
ggtactggcgcatcgaatgtcatccccggtgaatttgatgtgcagtttaacttccgcttt
agtacagagctcaccgatgaagagatcaaacgccgcgtacattcggtcttggatgctcac
gggctcgattacggtgtgaaatggactctcagcggccaacccttcctgaccgatacgggc
gaactactggcagcagtagtcgcggccgtagaggaagtaaaccatcaagctcctgcgtta
ttgacgacaggcggaacatctgatggtcgcttcattgcccaaatgggcgcacaagtggtt
gagctcggtcccgtgaatgccaccattcacaaggtaaacgagtgtgtacgtattgcggat
ttagagaaattgaccgatatgtatcaaaaaaccttaaatcatcttttaggctaa

DBGET integrated database retrieval system