KEGG   Vibrio cholerae O395: VC0395_A2534Help
Entry
VC0395_A2534      CDS       T00520                                 

Gene name
fadB
Definition
(GenBank) fatty oxidation complex, alpha subunit
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
vco  Vibrio cholerae O395
Pathway
vco00071  Fatty acid degradation
vco00280  Valine, leucine and isoleucine degradation
vco00281  Geraniol degradation
vco00310  Lysine degradation
vco00362  Benzoate degradation
vco00380  Tryptophan metabolism
vco00410  beta-Alanine metabolism
vco00640  Propanoate metabolism
vco00650  Butanoate metabolism
vco00903  Limonene and pinene degradation
vco00930  Caprolactam degradation
vco01040  Biosynthesis of unsaturated fatty acids
vco01100  Metabolic pathways
vco01110  Biosynthesis of secondary metabolites
vco01120  Microbial metabolism in diverse environments
vco01130  Biosynthesis of antibiotics
vco01200  Carbon metabolism
vco01212  Fatty acid metabolism
Module
vco_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    VC0395_A2534 (fadB)
   00650 Butanoate metabolism
    VC0395_A2534 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    VC0395_A2534 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    VC0395_A2534 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VC0395_A2534 (fadB)
   00310 Lysine degradation
    VC0395_A2534 (fadB)
   00380 Tryptophan metabolism
    VC0395_A2534 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VC0395_A2534 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VC0395_A2534 (fadB)
   00281 Geraniol degradation
    VC0395_A2534 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VC0395_A2534 (fadB)
   00930 Caprolactam degradation
    VC0395_A2534 (fadB)
Enzymes [BR:vco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     VC0395_A2534 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     VC0395_A2534 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     VC0395_A2534 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     VC0395_A2534 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABQ19542
UniProt: A5F465
Position
2:complement(2685981..2688152)
Genome map
AA seq 723 aa AA seqDB search
MIYQAKTLQVKQLANGIAELSFCAPASVNKLDLHTLESLDKALDALAADSSVKGLLLSSD
KEAFIVGADITEFLGLFAKPEAELDEWLQFANRIFNKLEDLPFPTLSALKGHTLGGGCEC
VLATDFRIGDATTSIGLPETKLGIMPGFGGTVRLPRLIGADSAMEIITQGKACRAEEALK
VGLLDAIVDSDKLIDSAITTLTQAIEEKLDWQKRRQQKTSALTLSKLEAMMSFTMAKGMV
AQVAGKHYPAPMTSVVTIEEAARLPRDAALDIERKHFIKLAKSTEAQALVGIFLNDQYIK
GLAKQSAKAASQDTQHAAVLGAGIMGGGIAYQSALKGVPVLMKDIAPHSLELGMTEAAKL
LNKQLERGKIDGFKMAGILASITPSLHYAGIDQADVIVEAVVENPKVKAAVLSEVEGLVD
AETILTSNTSTIPINLLAKSLKRPQNFCGMHFFNPVHRMPLVEIIRGEHTSEDTINRVVA
YAAKMGKSPIVVNDCPGFFVNRVLFPYFAGFSLLMRDGANFTEIDKVMERQFGWPMGPAY
LLDVVGIDTAHHAQAVMAEGFPTRMAKSGREAIDALYEAKKFGQKNGSGFYQYTVDKKGK
PKKAFSDDVLAILAPVCGAPQNFDPQTLIERTMIPMINEVVLCLEEGIIASAQEADMALV
YGLGFPPFRGGVFRYLDTIGIANYVAMAEKYADLGALYQVPQLLKNMAQQGTSFYSAQQA
SAL
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgatttaccaagccaaaaccctacaggtaaagcaactcgctaatggaattgccgagctc
tctttctgtgctcctgcttccgttaacaaactggatttacacacactggaatccctcgat
aaagcgttagatgcgctcgctgccgattccagtgtcaaaggcctcctactcagctcagat
aaagaggcttttatcgtcggcgctgatatcaccgaatttctcgggctatttgccaaaccg
gaagcagaattggatgagtggttgcagtttgccaatcgcatttttaacaagttggaagat
ttacctttccccaccttgtcagcgttaaaaggccacacacttggcggcggctgtgaatgt
gtactcgccaccgattttcggattggtgatgccaccaccagcattggcttgcctgaaacc
aaactgggcatcatgccgggatttggcggcaccgtgcgtctgccacgtttgattggtgct
gatagcgcgatggaaatcatcacccaaggtaaagcgtgccgcgcggaagaagccttaaaa
gtgggattactggatgcgattgtcgatagcgacaaactgatcgattccgcaatcaccact
ttgactcaagcgattgaagaaaaactggattggcaaaaacgccgtcagcagaaaacctca
gcgctgactttaagcaagctggaagccatgatgagctttaccatggcaaaaggcatggtg
gcgcaagtggcaggcaaacactatccagcaccgatgacatctgtcgtgaccattgaagaa
gcggcgcgtttaccacgcgatgctgcgctggatatcgagcgcaaacacttcatcaagctc
gcaaaatctaccgaggcgcaagcactggttggtattttcctcaatgatcaatacatcaaa
ggcttagccaaacaatccgcgaaagcggcaagccaagacacccaacacgccgccgtgctc
ggcgcgggcattatgggtgggggcatcgcgtatcaatcggctctcaaaggcgtacctgtg
ctgatgaaagacatcgcaccgcactctttagagttgggcatgaccgaagcggccaagctc
ctcaacaaacagttagagcgcggcaagatcgatggattcaaaatggctggtattctggct
tccatcaccccttctctgcattacgcagggattgatcaggcggacgtgattgtcgaagcc
gtggtggaaaatccgaaagtcaaagccgcggtactgagcgaagtggaaggattggtcgat
gcagaaacgattctgacctccaacacctcgaccattcccattaacctgctcgccaaatca
ctcaagcgcccacagaacttctgcggtatgcacttctttaaccctgtgcatcgcatgcct
ttggtggaaatcatccgtggtgaacacacctcagaagacaccatcaaccgagtggtggct
tatgcggcgaaaatgggcaaatcaccgattgtggtcaatgactgcccaggattcttcgtt
aaccgcgtactcttcccttactttgcaggctttagcctactgatgcgtgatggtgctaac
ttcaccgaaatcgacaaagtgatggagcgtcaattcggctggccaatgggcccggcgtat
ttgcttgatgtggtcggcattgatactgcacaccatgctcaggcagtgatggccgaaggc
ttcccaactcgcatggccaaatctggccgagaagcgattgatgccctgtacgaagcgaaa
aaatttggccagaaaaatggcagcggcttctatcagtacaccgttgataaaaaaggcaaa
ccgaaaaaagccttcagcgatgacgtgctcgccattcttgcgcctgtatgcggcgcacca
caaaactttgacccacaaacccttatcgaacgcactatgattccgatgattaatgaagtg
gtgctctgtcttgaagaagggatcatcgcctccgcgcaagaagctgacatggcgttggtg
tacggtcttggcttccctccgttccgtggtggtgtatttcgttacctagataccataggc
atcgccaactatgtggctatggcggaaaaatacgctgacctcggcgcgctctatcaagta
ccgcaactgctgaagaacatggcgcaacaaggaacatctttctacagcgctcagcaagcc
agtgccctgtaa

DBGET integrated database retrieval system