KEGG   Vibrio cholerae O395: VC0395_A2813Help
Entry
VC0395_A2813      CDS       T00520                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
vco  Vibrio cholerae O395
Pathway
vco00040  Pentose and glucuronate interconversions
vco00052  Galactose metabolism
vco00500  Starch and sucrose metabolism
vco00520  Amino sugar and nucleotide sugar metabolism
vco01100  Metabolic pathways
vco01130  Biosynthesis of antibiotics
Module
vco_M00362  Nucleotide sugar biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:vco00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VC0395_A2813 (galU)
   00052 Galactose metabolism
    VC0395_A2813 (galU)
   00500 Starch and sucrose metabolism
    VC0395_A2813 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    VC0395_A2813 (galU)
Enzymes [BR:vco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     VC0395_A2813 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 Smr
Motif
Other DBs
NCBI-ProteinID: ABQ19984
UniProt: A0A0H3AHQ7
Position
2:complement(2962719..2963642)
Genome map
AA seq 307 aa AA seqDB search
MVESAKNFSLAHHRAKMMIKKCLFPAAGYGTRFLPATKSMPKEMMPVVNKPLIEYGVDEA
IQAGITGMCIVTGRGKHSIMDHFDMNYELEHQIRGTNKEELLGDIRKIIESANFTFIRQR
EMKGLGHAILTGKELVGDEPFAVVLADDLCVNEEQGVLAQMVALYKQFRCSIVAVQEVPE
NETHKYGVIAGEMIKDDLFRVDNMVEKPEPGTAPSNLAIIGRYILTPDIFDLIEQTEPGK
GGEIQITDALLKQAKAGCVLAYKFKGKRFDCGSVEGYIEATNFCYENMYKKNDQKVELAK
KSTHKGQ
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
gtggtagagtcagcaaaaaatttctccctagcacaccatagagcaaaaatgatgattaag
aagtgtctatttccggcagctggctacggtacccgattcctaccagcgactaagtcgatg
cccaaagagatgatgcctgttgttaacaaaccgctgattgagtacggtgttgatgaagcg
attcaagcgggtatcacaggcatgtgtattgtgacaggtcgtggtaagcattcgatcatg
gatcactttgacatgaactacgagttagagcaccaaatccgcggtacgaataaagaagag
ctattgggtgatatccgtaaaatcatcgaaagcgctaactttacttttattcgccaacgc
gaaatgaaaggcttgggtcacgctatcttaacgggcaaagagctggtcggtgatgagccg
tttgccgttgtgctagcggacgacctgtgtgtgaacgaagagcaaggcgtactggcacag
atggttgcactgtacaaacagttccgctgctctatcgtcgctgtgcaagaggttccagaa
aacgaaactcacaaatacggcgtgatcgcaggtgagatgatcaaagacgatctgttccgc
gtcgataacatggtcgaaaaaccagagccgggcacagcgccaagcaacctcgccatcatt
ggccgttatatcctcacgccagatatttttgatctgattgagcagaccgagccgggcaaa
ggcggtgaaattcaaatcactgacgcgctgctcaaacaagccaaagcgggttgtgtactg
gcttataaattcaaaggtaagcgcttcgactgtggtagcgttgaaggctatatcgaagcc
accaacttctgctacgaaaacatgtacaagaaaaacgaccaaaaagtggagttggctaaa
aagtcgacgcacaaaggtcagtaa

DBGET integrated database retrieval system