KEGG   Vagococcus carniphilus: H9L18_06415
Entry
H9L18_06415       CDS       T06797                                 

Definition
(GenBank) ornithine aminomutase subunit alpha
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
vcp  Vagococcus carniphilus
Pathway
vcp00472  D-Arginine and D-ornithine metabolism
vcp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    H9L18_06415
Enzymes [BR:vcp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     H9L18_06415
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A HSBP1 DUF1192
Other DBs
NCBI-ProteinID: QNN74209
Position
1282739..1283098
AA seq 119 aa
MKEVTFEEARKHLAGLSDDELKERFWALSEEIMEPMLEMGREYTSPSIERSILLRMGFSS
TEATEIVNRVLAHELMGKGAGHIVYRIAKEKNIEVREAGVKLSEGEYWDDVLNIFKGGN
NT seq 360 nt   +upstreamnt  +downstreamnt
atgaaagaagtaacatttgaagaagcaagaaaacatcttgctggcttatcagacgatgaa
ttaaaagagcgtttctgggctttatcagaagaaattatggaacctatgttagaaatgggt
agagagtatacttctccatctatcgaacgttctattttactaagaatgggattttcttca
actgaagcaacagaaatcgtaaaccgtgtattagctcatgaattaatgggtaaaggtgct
ggacatattgtttaccgcatcgctaaagaaaaaaatattgaagtaagagaagccggagta
aaattaagcgaaggcgaatattgggacgatgttcttaatattttcaagggaggtaactaa

DBGET integrated database retrieval system