KEGG   Vagococcus carniphilus: H9L18_06420
Entry
H9L18_06420       CDS       T06797                                 

Definition
(GenBank) cobalamin B12-binding domain-containing protein
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
vcp  Vagococcus carniphilus
Pathway
vcp00472  D-Arginine and D-ornithine metabolism
vcp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vcp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    H9L18_06420
Enzymes [BR:vcp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     H9L18_06420
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: QNN74210
Position
1283101..1285320
AA seq 739 aa
MSETIKLDKNKKLDVKEILTDLENYRPKRRGWVWRTPVPNYQLHKFEYKDMAESLKQSVP
LPSAKYFGNIDPQGTSSITTEIASGRFEDDIRRMRMAAWHGADHIMVIRTAGQSHFEGLI
EGTPQGIGGIPITRKQVRAQRKALDAIEEEVGRPINYHSYVSGIAGPEVAVMFAEEGVNG
AHQDPQYNVLYRNINMVRSFVDACESKKVMAWAGIAQIDGAHNANATAREAWKVMPELMV
QHALNSVFSYKVGMDKSDICLSTVPPTAPPAPSMFLDLPYAVALREFFSEYRMRAQQNTK
YMEASTREATVTHVLNLLISKLTSADIQSTITPDEGRNVPWHIYNVEAVDTAKQVFQGLD
GFNEMVQLKDDGPLREQAREIKERSVLFLEGMIEAGGYFQSVEDAFFVDSGNYPERNEDG
ISRKINGGVGADTIYKRDEDYMAPVTAHFGYNNVAQYDESAVEDPAKLIGGSTFEKPEKI
IFIDELDENDNVNLRLEETKEFREEGLIKPEAEWQGDGTVLLTFMIPESSRVAEFAALEM
GKKMGLDDCEVINKEVMQAAEGTRIEMKGRLPFAIEKDSLIIPEEPIVMSDDEIREDIKR
KKMVIVAGTVGEDEHSVGLREIIDIKHGGIERFGIEVHYLGTSVPVEKLVDAAIEMNADA
ILASTIISHDDIHYKNMQRINDLAIEKGIREKIMIMAGGTQVIPEIATKHGMDAAFGRGT
NGSNVATALVERRREMEEK
NT seq 2220 nt   +upstreamnt  +downstreamnt
atgtcagaaacaattaaattagataaaaataaaaaattagatgttaaagagattcttact
gatttagaaaactaccgccctaaacgtcgtggttgggtatggagaactccagtaccaaat
tatcaattacataaatttgaatacaaagatatggctgaatcattgaaacaatctgttcca
cttccatcagctaaatactttggaaatatcgaccctcaaggtacgtcatcaattacaact
gaaatcgcttctggtcgttttgaagatgatatcagacgtatgcgtatggctgcttggcac
ggtgctgaccatatcatggttatcagaactgctggtcaatctcactttgaaggattaatt
gaaggaacacctcaaggtatcggtggtatcccaattactagaaaacaagttcgtgctcaa
agaaaagcattagatgctattgaagaagaagtaggacgtccaattaactaccatagttat
gtatctggtattgctggacctgaagtggctgttatgtttgctgaagaaggcgtaaacgga
gcccatcaagatccacaatataacgttttataccgtaacattaacatggttcgttcattc
gtagatgcttgtgagtctaaaaaagttatggcttgggctggaattgctcaaatcgacgga
gctcataatgcgaatgcaactgctcgtgaagcttggaaagttatgcctgagttaatggta
caacatgctcttaactctgtattctcatataaagttggtatggataaatctgacatctgt
ctatctactgtacctccaacagctccaccagcaccatcaatgttcttagatttaccttac
gctgtagcattacgtgaattctttagtgaataccgtatgcgtgcacaacaaaatacaaaa
tacatggaagcttcaactcgtgaagcaactgtaactcacgtacttaacttattaatttct
aaattaacaagtgcagatattcaatcaacaattactcctgatgaaggccgtaatgttcct
tggcatatttataacgttgaagctgtagatactgctaaacaagtattccaaggcttagat
ggatttaatgaaatggttcaattaaaagatgatggaccattgcgagagcaagcacgtgaa
attaaagagcgttctgtgttattcttagaaggaatgatcgaagctggcggatacttccaa
tcagttgaagatgcgttcttcgttgactcaggtaactaccctgaaagaaatgaagacgga
atttcaagaaaaatcaacggtggagttggcgccgacacaatttacaaacgtgacgaagat
tatatggctccagttacagctcactttggttataataatgtggctcaatatgacgaatca
gctgttgaagatccagctaaattaattggtggatcaacatttgaaaaaccagaaaaaatc
atctttattgacgaattagacgaaaatgataacgttaatttacgtcttgaagaaacaaaa
gaattcagagaagaaggtttaatcaaacctgaagctgaatggcaaggtgacggaacagtt
ctattaacatttatgatcccagaatcatctcgtgttgcagaatttgcagctcttgaaatg
ggtaaaaaaatgggcttagatgactgtgaagttatcaataaagaagtaatgcaagcagca
gaaggaactcgtatcgaaatgaaaggtcgtttaccatttgccattgaaaaagattcatta
atcatcccagaagaaccaatcgttatgtctgatgatgaaattcgtgaagatatcaaacgc
aagaaaatggtaatcgtagctggtactgtcggcgaagacgagcattcagttggattaaga
gaaattattgatattaaacacggcggaatcgaaagatttggaattgaagttcactactta
ggtacaagtgttcctgtagagaaattagtagatgcagcaatcgaaatgaatgctgatgct
atcttagcttctacaatcatcagtcatgatgacattcactacaaaaacatgcaacgtatc
aatgatttagcaatcgaaaaaggaatccgtgagaaaattatgatcatggctgggggaact
caagttattcctgaaatcgctactaaacatggtatggacgcagcatttggacgtggaaca
aatggatctaacgtagcaactgcattagttgaaagacgtcgggaaatggaagaaaaatag

DBGET integrated database retrieval system