KEGG   Vibrio cholerae O1 2012EL-2176: EN18_00155
Entry
EN18_00155        CDS       T03389                                 
Name
(GenBank) hypothetical protein
Organism
vcq  Vibrio cholerae O1 2012EL-2176
SSDB
Other DBs
NCBI-ProteinID: AIT31247
UniProt: A0A655TVF7
Position
2:32363..32590
AA seq 75 aa
MIWFPEPTATGLSIVENKHPIYTIRITCGSPDNICHEGLFEYKGNTLSKIEIRDFASYLG
EEITLTNGETLEPMN
NT seq 228 nt   +upstreamnt  +downstreamnt
atgatttggttcccagagcccacagcaacgggtctcagtattgtagagaataaacatcct
atctatacgattcgtataacgtgtggctctccggataatatttgccatgaaggcctattt
gagtacaaagggaacacactaagcaaaattgagataagagattttgctagctatttaggt
gaagaaatcaccttaacgaatggtgaaaccttagaacctatgaattga

DBGET integrated database retrieval system