KEGG   Vibrio cholerae O1 2012EL-2176: EN18_01820Help
Entry
EN18_01820        CDS       T03389                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq00071  Fatty acid degradation
vcq00280  Valine, leucine and isoleucine degradation
vcq00310  Lysine degradation
vcq00362  Benzoate degradation
vcq00380  Tryptophan metabolism
vcq00620  Pyruvate metabolism
vcq00630  Glyoxylate and dicarboxylate metabolism
vcq00640  Propanoate metabolism
vcq00650  Butanoate metabolism
vcq00900  Terpenoid backbone biosynthesis
vcq01100  Metabolic pathways
vcq01110  Biosynthesis of secondary metabolites
vcq01120  Microbial metabolism in diverse environments
vcq01130  Biosynthesis of antibiotics
vcq01200  Carbon metabolism
vcq01212  Fatty acid metabolism
vcq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    EN18_01820
   00630 Glyoxylate and dicarboxylate metabolism
    EN18_01820
   00640 Propanoate metabolism
    EN18_01820
   00650 Butanoate metabolism
    EN18_01820
  09103 Lipid metabolism
   00071 Fatty acid degradation
    EN18_01820
   00072 Synthesis and degradation of ketone bodies
    EN18_01820
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EN18_01820
   00310 Lysine degradation
    EN18_01820
   00380 Tryptophan metabolism
    EN18_01820
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EN18_01820
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EN18_01820
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EN18_01820
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vcq04147]
    EN18_01820
Enzymes [BR:vcq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EN18_01820
Exosome [BR:vcq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EN18_01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIT31553
UniProt: A0A0H7AVI6
Position
2:complement(329883..331088)
Genome map
AA seq 401 aa AA seqDB search
MEKIYIVGAKRSAIGAFGGSLKECSAGALAGQVIQAALEAAQLKPEAVDEVIVGNVVSAG
QGMGVGRQAALAAGVPQSVPAYSINMVCGSGMKSVMDAVAHIKAGDASVVVAAGVEVMSQ
IPFVTPASLRDGQKMGAFEVKDLLIHDGLTDVFNQYHMGVTAENIAKQYDIARQTQDEFA
LASQMKATAAIEAGHFKREIVPISVKKRRETVVFDTDEYPKPTTTLAALQGLRAAFDAQG
TVTAGNASGINDGASAVIIASESAVKKLGLTPIAEIMSYAQTGLDPKVMGLGPVSAVTQA
LAKAELSITQVDLFELNEAFAAQALGVVYGLAEQHAIQPEAILEKANVNGGAIALGHPLG
ASGNRILVTLLHELQRRQKHYGVASLCVGGGMGTAIVIKTV
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagatctatatcgtgggcgcaaagcgctcagctatcggagcctttggtggttca
cttaaagagtgttcagcaggcgctttggcagggcaagtcatccaagccgctcttgaagcc
gcacaactcaaacctgaagctgtggatgaagtgattgttggtaacgttgtgagtgccgga
caaggcatgggtgttgggcgtcaagcggctttagcggctggtgttccacagtcggttcca
gcttacagcatcaacatggtgtgtggcagtgggatgaaatcggtgatggatgcggttgcg
cacatcaaagcgggagatgcttctgtcgttgttgccgctggtgttgaggtcatgtcacaa
atcccatttgttacgcctgccagcttacgagatgggcagaaaatgggcgcgtttgaagtg
aaagatctgctcatccatgacggtctgaccgatgtcttcaatcaataccacatgggtgtg
acggcagaaaatatcgctaaacagtacgacatcgctcgtcaaacacaagatgagtttgcg
ttggccagccaaatgaaagcgacagcggccattgaagccggacattttaagcgagaaatt
gtgcctatttcggtcaaaaaacgccgtgaaaccgtcgtgtttgatacggatgaataccct
aaaccgacgaccacgttggcagcattgcaaggcttacgcgccgcgttcgatgcacaaggt
acggttaccgcaggtaatgcttctggaattaacgatggtgccagtgcggtgattatcgcc
agtgaaagtgcggtaaaaaaactaggcttaacccctatcgcagaaattatgagttatgca
caaacagggttggatccgaaagtcatgggcttagggcctgtgagtgcagtcactcaagca
ttagcgaaagcagaattatctatcactcaggttgatctgtttgaacttaacgaagcgttt
gccgctcaagcattaggtgtcgtttacggtttagctgagcaacacgcgattcaacctgag
gcgattttagaaaaagccaacgtcaatggcggtgccattgcgttagggcatccattaggg
gcatcgggtaaccgcattctggttactctgcttcatgaattacagcgtcgccaaaaacat
tatggcgttgcttcactctgcgtcggcggtggcatgggtaccgcgatcgtgattaaaaca
gtttaa

DBGET integrated database retrieval system