KEGG   Vibrio cholerae O1 2012EL-2176: EN18_03865
Entry
EN18_03865        CDS       T03389                                 

Name
(GenBank) membrane protein
Organism
vcq  Vibrio cholerae O1 2012EL-2176
SSDB
Motif
Pfam: DUF4123
Other DBs
NCBI-ProteinID: AIT31945
UniProt: A0A023PTD7
Position
2:796590..797477
AA seq 295 aa
MRSTNSFVVHNWVSLVPEMEMDTQERLYLLVDGAQISHLAQALYRLSGELVLEPLYLFPP
FEQLKEVSPYLVLATDTVKTWFLEQNQGLAGFFFASLDSIEEIAEQLRRLIQVESPYGST
VFLKMANSECAYVLLSTQCQPLWKVINRAWLPTRQGWQYVQRPELTATQDTPVRFKLTDE
QWQRLGNITWLNTLETVERHVQQWFPDLAQQWQSDPELFHRHAQWAYQQGFSSERDLMLF
FNVLGFLGVDALEKGKYPEIDPLLHQASSRTPSQRIEAAAELAYQHSQSSQEVQG
NT seq 888 nt   +upstreamnt  +downstreamnt
atgcgttcaacaaattcctttgtcgtgcataactgggtgagcttggttccagagatggaa
atggatacacaagaaaggctttaccttttggttgatggtgctcaaatcagccatctagca
caagccttgtatcgtctatcgggtgaattggttttggagcctttgtacctttttccgcct
tttgagcagcttaaagaggtgtctccttatctcgtgttagcaacggatacggttaaaacc
tggttccttgagcagaatcaggggttagctgggttcttttttgcttctttagattctatt
gaagagattgctgaacaactgcgtcgtttgatccaagtggagtccccttatggttcaacg
gtgtttcttaaaatggcgaacagtgaatgcgcgtatgtacttttgagtacccaatgccaa
ccgctgtggaaagtgatcaatcgagcttggttgccgacacgtcaaggttggcaatatgtg
caacgacccgaactgacggcgactcaagacactcctgtgcgattcaagttaaccgatgag
cagtggcaacggcttggcaacatcacatggcttaataccttagaaacggtcgagcggcat
gtgcagcagtggttcccggatttagcgcagcagtggcagtctgaccctgaactatttcat
cgtcatgctcaatgggcttaccagcagggctttagcagtgagcgagatttaatgctgttt
tttaatgtgttggggtttttaggtgttgatgctcttgaaaaagggaagtatcccgagatt
gatcctttgttgcatcaggcttcaagtcgtacgccttcgcaacgcattgaagctgccgca
gagctggcttatcaacattcacaatcatcacaggaggtacaaggatga

DBGET integrated database retrieval system