KEGG   Vibrio cholerae O1 2012EL-2176: EN18_04265
Entry
EN18_04265        CDS       T03389                                 
Name
(GenBank) type VI secretion protein
  KO
K11900  type VI secretion system protein ImpC
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_04265
Secretion system [BR:vcq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EN18_04265
SSDB
Motif
Pfam: VipB VipB_2 DMP12
Other DBs
NCBI-ProteinID: AIT32023
UniProt: A0A085SGI6
Position
2:891474..892949
AA seq 491 aa
MSTTEKVLERPQLAQGSLLDEIMAQTRIAPSEEGYDIAKKGVAAFIENLMGSQHSAEPVN
KSLVDQMLVELDKKISAQMDEILHNSQFQAMESAWRGLKLFVDRTDFRENNKVEILHVTK
DELLEDFEFAPETAQSGLYKHVYSAGYGQFGGEPVGAIIGNYAFTPSTPDMKLLQYMGAL
GAMAHAPFISSVGPEFFGIDSFEELPNIKDLKSTFESPKYTKWRSLRESEDARYLGLTAP
RFLLRVPYDPIENPVKSFNYAENVSASHEHYLWGNTAFAFATRLTDSFAKYRWCPNIIGP
QSGGAVEDLPVHVFESMGALQSKIPTEVLITDRKEFELAEEGFIALTMRKGSDNAAFFSA
NSIQKPKVFPNTKEGKEAETNYKLGTQLPYMMIINRLAHYVKVLQREQIGAWKERQDLER
ELNSWIKQYVADQENPPADVRSRRPLRAARIEVMDVEGNPGWYQVSLSVRPHFKYMGANF
ELSLVGRLDQA
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgtctacgactgaaaaggtattggaaaggccacagcttgctcaaggcagccttcttgat
gaaattatggcgcaaacccgtatcgcaccaagcgaagagggttacgacatcgcgaaaaaa
ggtgttgcagcgtttatcgaaaatcttatgggttcacaacactctgctgagcctgtcaac
aaatctctggttgaccaaatgttggttgaactggataaaaaaatcagtgcacagatggat
gaaatcctgcacaactcacaattccaagcgatggaatcggcgtggcgcggtttgaagctg
ttcgtggatcgcactgattttcgtgaaaataacaaagtcgaaatccttcacgtaaccaaa
gatgaactgctggaagatttcgagtttgctccagaaacggctcagtccggtctttacaag
cacgtttattctgccggttatggtcaatttggtggcgaacctgttggcgcgatcattggt
aactatgcgtttaccccttcaacgccagatatgaagctgctgcaatacatgggcgcactg
ggtgccatggcgcatgctcctttcatttcaagcgtaggtcctgaattctttggtatcgac
tccttcgaagaactgcctaacattaaagatctcaagtcgacatttgaaagcccgaaatac
accaaatggcgttcactgcgtgaatcggaagatgctcgctatcttggtttgactgcgcct
cgtttcctgctgcgtgttccttacgatccaatcgaaaatccagtgaagtcgttcaattat
gcggaaaacgtcagtgcttcgcacgagcactacctgtggggtaacacggcatttgccttc
gcaactcgtttgacggatagctttgctaaatatcgctggtgtccaaacattatcggtcca
caaagtggtggtgcagttgaagatctgccggtgcatgtctttgaatctatgggtgcattg
caaagcaagatcccaaccgaagtcctgatcacggaccgtaaagaatttgaactggcggaa
gaaggttttattgctcttactatgcgtaaaggcagtgataacgcggcgttcttctctgca
aactccattcaaaaacctaaggttttcccaaataccaaagaaggcaaagaagcggaaacc
aactacaagttgggtacccagttgccgtacatgatgatcatcaaccgtttggcgcactat
gtgaaagttctgcaacgtgagcagatcggtgcttggaaagagcgtcaagatcttgagcgt
gaactgaactcatggatcaaacaatacgttgctgatcaagagaacccacctgcagacgta
cgtagccgtcgtccacttcgtgctgcgcgcattgaagtgatggatgtggaaggcaatcca
ggttggtatcaggtgtcgctctcggttcgtcctcactttaagtacatgggtgcgaacttt
gagttgtcattagttggacgtcttgatcaagcctga

DBGET integrated database retrieval system