KEGG   Vibrio cholerae O1 2012EL-2176: EN18_04290
Entry
EN18_04290        CDS       T03389                                 
Name
(GenBank) type VI secretion protein
  KO
K11906  type VI secretion system protein VasD
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EN18_04290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_04290
Secretion system [BR:vcq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EN18_04290
SSDB
Motif
Pfam: T6SS-SciN LPAM_1
Other DBs
NCBI-ProteinID: AIT32028
UniProt: A0A2A1YU60
Position
2:897637..898113
AA seq 158 aa
MNKVLWMLFALTVLTACSSSDKYEPAKEPTKVTFSLVSDEGVNPNIWGEASPIEIQVFEL
KDDSMFMSSDYDQIKTDYKKALRSNFVKNYDYVLTPGQFKFVNAFEVDEETNYIGVMAHF
AEPELSEWKKAVKVINKGREYHLLMLFKDYDVKLDRVE
NT seq 477 nt   +upstreamnt  +downstreamnt
gtgaacaaagtgctgtggatgctgtttgccttgacggtactgaccgcgtgcagttcgtcg
gataagtacgagcctgcgaaagagccgaccaaggtgacttttagcttagtcagcgatgaa
ggggtgaacccgaacatctggggtgaagcgtcaccgatagaaattcaagtttttgagcta
aaggatgactcgatgtttatgtcgtccgactacgaccagatcaaaaccgattataaaaaa
gcgctgcgcagtaactttgttaaaaactacgactatgtactgactccagggcagttcaaa
ttcgtcaacgctttcgaagtcgatgaggagaccaactacatcggcgtgatggctcatttt
gccgagcctgaactcagcgaatggaagaaagcggtcaaggtgatcaataaagggcgagag
tatcacttgctgatgctgtttaaagactacgatgtgaaattggatagggtggaataa

DBGET integrated database retrieval system