KEGG   Vibrio cholerae O1 2012EL-2176: EN18_04295
Entry
EN18_04295        CDS       T03389                                 
Name
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_04295
Secretion system [BR:vcq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EN18_04295
SSDB
Motif
Pfam: T6SS_VasE GMP_synt_C
Other DBs
NCBI-ProteinID: AIT32029
UniProt: A0A023PT89
Position
2:898120..899454
AA seq 444 aa
MFARNRVIWNEGLFIKPQHFQQQQRYTEYCLDERLSTVSRYLYGISELSLNPEYLSFGRI
AIERAVGVMPDGTTFRIPQEDHLPDALEVTDASLANQIVYLAVPLRSESLMEINWPEERG
TGRYVSRRLEVRDVHSVQGDTTTIDVSPVRLQLMLEREDRSAYASIAIGRILEKRPDGSV
VLDPDFIPCHLNVVGISALHRFINEMSGLMRERAKNIAQRISSPAQGGVADVSDFMLLQA
LNRLQPQMKHLAELRSLHPERLFECLSCVCGELATFTDESRLPPSLPSYNHDSPSHSFQP
LIRSLRQSLSVVLEPRAVSIQLDKRKYGLMVAPIHDPQLMESAEFIIAVKARMPLDELRR
LFTQQTKVASVEKIRELISLQLPGIPLTPLPVAPRQLPYHAGYTYYQLDKTSAAWAMLTH
SSGFAFHVAAAFDDLELQFWAIRS
NT seq 1335 nt   +upstreamnt  +downstreamnt
atgtttgcgcgtaaccgagtgatctggaatgaagggctatttattaagccgcaacatttc
cagcaacagcagagatatacggagtactgcctagacgagcgcctgagcaccgtgagccgt
tacttgtatgggatttccgagttgtcgctcaacccggaatacctctcgtttggccgtatt
gcgattgagcgtgcggtcggcgtgatgcccgatggcaccacctttcgtattcctcaagaa
gatcatcttcccgatgcgctcgaagtgaccgatgcgtcattggcaaaccagattgtctac
ttagccgtaccgctacgtagtgagtcgctgatggagattaactggccagaagagcgtggt
acggggcgctatgtcagccgtcgtctcgaagtgcgtgatgtccatagcgtgcagggtgat
accacgacgattgatgtttcccctgtgcgtttgcaactcatgcttgagcgagaggatcgc
agtgcgtatgcctcaattgctattggccgtattttagaaaaacgtcctgatggcagcgtg
gtgctcgatccggatttcatcccttgtcacttgaatgtagtgggcatctctgcgctgcac
cgctttattaatgagatgtcaggcctgatgcgtgagcgagcgaaaaatattgctcagcgc
atcagctctccagcacaaggtggggttgctgatgtttcggactttatgctgctgcaagct
ttaaaccgtctgcaaccacaaatgaagcatttggcagagctgcgcagcttacacccagag
cgtctgtttgaatgtctctcgtgtgtgtgtggtgagctggctacctttactgacgaaagt
cgtctgccgcccagtttgccaagctataaccatgattcacccagccactctttccagccg
ctgatccgcagcttgcgtcagagcttgagcgtggtgctagagccgcgtgccgtctctatc
caactggataaacgtaagtacggtttgatggttgcgccaatccatgatccgcaactgatg
gagagtgcagagtttatcatcgcggttaaagctcgcatgccgttggatgagctacgccgt
ctgtttactcagcaaaccaaagtggcatcggttgagaaaattcgtgaactcatctcactg
caactgccgggtattccattgacgccattacccgtcgcaccgcgccaattgccttaccac
gctggctacacctactaccaactggataaaaccagcgctgcatgggcgatgttgactcat
tccagcggttttgcgttccacgttgctgcagcttttgacgatcttgagctgcaattctgg
gctatcaggagctaa

DBGET integrated database retrieval system