KEGG   Vibrio cholerae O1 2012EL-2176: EN18_04320
Entry
EN18_04320        CDS       T03389                                 
Name
(GenBank) type VI secretion protein
  KO
K11910  type VI secretion system protein VasJ
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcq02044]
    EN18_04320
Secretion system [BR:vcq02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EN18_04320
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N Dpoe2NT
Other DBs
NCBI-ProteinID: AIT32034
UniProt: A0A023PTI1
Position
2:905123..906532
AA seq 469 aa
MEMTEYRQCVAKPISSSNPVGERLVDHPLFDFIEDQMMKVGSLSHASVQWDEVEHSTLKL
LGEQSKDIKLLVYLLQCLHNQVTPTRLITSFAVMSEFLNQYWNDSYPAPGPRGNLPRRKF
FSQMAQRFTTVIEKFDFHHLDEADRQALQAAVEEWQQAVEKQGLSSELVESVVVRITAEI
KRAEQRQQVTAQSSAERETPSAATPSPAASMVVDHSSDKAAKQTLLKVADFLAEQEFGIA
LSIRLRRFAVWGSITSLPDHKPDGETLLRGMQADRVKDYQDQLRHPDLALWRKVEQSLTM
APYWFEGQWMSYTIAQQLGKSDWCQAIAEETQQFLRRLPSLLELKFKGGEPFVSDSVKEW
LASVGQSQGAAGQSVGGDWQEKRKEAFQLAKEGGIAVALSMLNDGLVSAVEPRDKFYWRL
LSADLLRANHLDAMAGEQYQTLLNQVTTLSVPEWEPSLVEQIQRYTTSE
NT seq 1410 nt   +upstreamnt  +downstreamnt
atggaaatgactgaataccgtcagtgtgtggccaaaccgatcagcagtagcaatcctgtc
ggagagcggctagtcgatcacccactgtttgattttattgaggatcagatgatgaaagtg
ggctctctctctcacgcttcagtgcagtgggatgaagtggagcacagcactctcaaactg
cttggtgaacagagtaaagacatcaagcttttggtttacctgctgcagtgtctgcataac
caagttaccccgacgcgccttattacctcgtttgcggtgatgagtgagttcctcaatcaa
tattggaacgacagttatccagcgccgggcccacgtggcaatctgccgcgacgtaaattt
ttcagccagatggcgcaacgttttaccacggtgatcgaaaagttcgattttcatcatctg
gatgaagcggatcgccaagcgctacaagcggcggttgaagagtggcaacaagccgttgag
aaacaagggctctcttctgagttggtggagtctgtggtggtgcgaattaccgcggagatc
aaacgcgcagagcagcgccagcaagtgacggcgcaaagcagcgcggagcgtgaaacacca
agtgctgcaacgccttctcctgcggcgagtatggtggtggatcattcgagtgacaaagca
gcgaaacaaaccctactcaaagtggcagattttcttgccgaacaagagtttggtatcgct
ctttcgattcgtctgcgccgctttgcggtgtggggcagcattacctcattgcccgatcat
aaacccgatggtgaaacactgctgcgtggaatgcaggcggatcgcgtcaaggattaccaa
gatcaacttcgtcaccccgatttagccttgtggcgcaaagtcgaacagagcttaaccatg
gctccttattggtttgaaggacagtggatgagttacaccattgcccagcaactcggcaaa
agtgattggtgtcaggcgattgccgaagaaacacaacagtttttacgtcgtttgccttcg
ctgcttgagctcaaattcaaaggcggagagccgtttgtcagcgattcggtcaaagagtgg
ctggcgagcgtaggtcagagccaaggtgctgcggggcaatcggtcggcggagattggcaa
gagaagcgtaaagaggcgtttcaactggctaaagaaggtggaatcgcggtggcactttcc
atgctcaatgatggcttggtcagtgcggtggagccgcgagacaaattttactggcgattg
ctatcggcagatctgctgcgggcaaatcatctcgatgcgatggctggtgaacagtatcaa
actctgctcaatcaggtaacgacgctgtctgttcctgagtgggaaccgagtttagtggaa
caaattcaaagatatacaacgtcagagtaa

DBGET integrated database retrieval system