KEGG   Vibrio cholerae O1 2012EL-2176: EN18_10010Help
Entry
EN18_10010        CDS       T03389                                 

Definition
(GenBank) maleylacetoacetate isomerase
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq00350  Tyrosine metabolism
vcq00643  Styrene degradation
vcq01100  Metabolic pathways
vcq01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    EN18_10010
  09111 Xenobiotics biodegradation and metabolism
   00643 Styrene degradation
    EN18_10010
Enzymes [BR:vcq01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     EN18_10010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_3 GST_C GST_C_2
Motif
Other DBs
NCBI-ProteinID: AIT29375
UniProt: D5LMA0
Position
1:907157..907801
Genome map
AA seq 214 aa AA seqDB search
MSLILYGYWRSSAAYRVRIALNIKQLVYESRAVHLSREGGEQHHAEFHRLNPSELIPVLI
DGELCLNQSLAIIEYLDETYPAPRLIPERGAERYQVKALALDIAADIHPINNLRILQYLT
AKLGVADEEKNRWYRHWIDKGFQGLEEKLRHTAGEYCVGNRLSLVDVCLVPQVYNAERFD
LDMSRYPTLQQIAARLRALPAFAQAAPENQPDAC
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgagtttaattctctatggttattggcgttcgtcagccgcctatcgagtgcgtattgcc
ctcaatattaaacagttggtttacgagtcacgcgccgtgcatcttagccgtgagggaggg
gagcagcatcatgccgagtttcatcgcctcaatcctagcgagttgattcctgtgcttatc
gatggtgagctctgcttgaatcaatcgctggcgattattgagtatttggatgaaacctat
cccgccccccgtttgatcccagagcgaggtgccgagcgttatcaggtgaaagcgttagcg
ttagacatcgcagcggatatccatccgatcaataacttgcggattttgcagtatcttacc
gcaaagcttggtgtggccgatgaagaaaaaaatcggtggtatcgccactggattgataaa
ggttttcaaggtttggaagagaaattgcgccatacggcaggggaatattgtgtgggtaat
cgcttgtctctggtcgatgtctgtttagtgcctcaagtttataacgctgagcgatttgat
ctcgatatgagtcgttatcccaccttacagcagatcgcagcaaggttacgtgctttgcct
gcgtttgcgcaggctgctccagaaaatcagcctgacgcttgttga

DBGET integrated database retrieval system