KEGG   Vibrio cholerae O1 2012EL-2176: EN18_15305Help
Entry
EN18_15305        CDS       T03389                                 

Definition
(GenBank) histidine kinase
  KO
K07678  two-component system, NarL family, sensor histidine kinase BarA [EC:2.7.13.3]
Organism
vcq  Vibrio cholerae O1 2012EL-2176
Pathway
vcq02020  Two-component system
vcq05111  Biofilm formation - Vibrio cholerae
Brite
KEGG Orthology (KO) [BR:vcq00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    EN18_15305
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   05111 Biofilm formation - Vibrio cholerae
    EN18_15305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vcq01001]
    EN18_15305
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:vcq02022]
    EN18_15305
Enzymes [BR:vcq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     EN18_15305
Protein kinases [BR:vcq01001]
 Histidine kinases
  NarL family
   EN18_15305
Two-component system [BR:vcq02022]
 NarL family
  BarA-UvrY (central carbon metabolism)
   EN18_15305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2222 Response_reg HATPase_c HisKA Hpt HAMP HATPase_c_3 Baculo_PEP_C APG17
Motif
Other DBs
NCBI-ProteinID: AIT30390
UniProt: A0A0H7CNC0
Position
1:2105185..2107935
Genome map
AA seq 916 aa AA seqDB search
MTLTLAPTLIIGLLLSALFSFNRYHDLETQVINSGASIIEPLAIASEDALRMQSRESVRR
IISYAHRKNSKLVRSIAVFDANHELFVTSNFHPNFEKLMYPKDKPIPFLSSSVIDENTLI
LRTPIISERTVLDNGDANPATPVMGYIAIELDLSSLRLQQYQEIFSAGLVLVIGILLSGV
FASRLMYDVTRPITHMKNMVDRIRRGHLDVRIEGKMHGELDTLKKGINAMAVSLSEYHVE
MQHSIDQATSDLRETLEQLEIQNVELDIAKKRAQEAARVKSEFLANMSHELRTPLNGVIG
FTRQMLKTQLTNSQADYLQTIEKSANNLLTIINDILDFSKLEAGKLALENIPFEFQEVLE
EVVNLQATSAHEKGLEITLKIDPKIPRGVVGDPLRIQQVLTNLVGNSIKFTERGNIDVSV
EMRALRDDVIDLQFMVRDTGIGISERQQAQLFQAFSQADASISRRYGGTGLGLVITQKLV
SHMGGEISLTSRLHQGSTFWFTLRLHTTELPLNDGYNADSLNHRHLLLIEPNMQAAAIVQ
QTLVQSGLEVTYRSAIPEEQHVYDYVLLNLAPSKETNPTLVELWVQRALAMTHNVIVGVP
STELALADQLMQRYPVKCISKPLSRKKLLQTLAAQQPQLANTSLPKPQADKLPLCVMAVD
DNPANLKLITALLQERVEYVVSCTSGQEAIEQAQSRQFDIILMDIQMPHMDGVTACKAIK
QLKGYRDTPVIAVTAHAMAGERDRLLKAGMDDYLTKPIEEHILQQVLVHWSPHTRSKQVA
KVTPPDGAAVISNALPSSPPAEEAIIDWPVALRQSANKEDLAKEMLGMLVDYLREVETVV
NTALEDEEYPASDLLHHIHKLHGSCSYSGVPRLRKICASLEQALRNGASIDELEPELFEL
QDEMAKVLEASRDYLN
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcactttggcacctaccctgattattggtctgctgcttagcgctctgttctct
tttaaccgttatcacgatttagaaactcaagtgatcaattccggtgccagcatcattgag
ccattagcgatcgccagtgaagatgcgctgcgtatgcagagccgagaatcggtgcgacgc
attatcagctatgcccaccgtaaaaattctaagttagtacgcagcatcgcggtgtttgat
gccaatcatgagctgtttgtcacctcgaacttccaccccaatttcgaaaagctgatgtat
cccaaggataagccgatcccgtttctgagtagttccgtgattgacgagaacacgctgata
ttacgaacgccgatcatttctgaacgcaccgtgctcgacaatggcgatgctaatcccgcc
acaccggtgatgggttatattgcgatagaactggatctctcctcactgcgtttacaacag
tatcaggaaattttttccgctggtttagtgctagtgatcgggattttgctgtcaggggta
tttgcttcgcgcttgatgtacgatgtgactcgcccaatcactcacatgaaaaatatggtc
gaccgcattcgtcgcggccatttggatgtgcggattgaaggtaaaatgcacggcgagttg
gatacgctgaaaaaaggcatcaacgcgatggcggtatcgctctccgaataccatgtcgaa
atgcagcacagtatcgaccaagcgacgtccgatctccgggaaacccttgaacagcttgag
attcaaaacgttgaactcgatattgccaaaaagcgcgctcaagaagcggcacgagtaaaa
tccgaatttctggctaacatgtcccatgagctgcgcaccccactcaatggtgtgattggt
tttacgcggcaaatgctgaaaacccagttgaccaacagccaagcagattatctacaaacc
attgaaaaatcagccaataaccttctcaccatcatcaatgacattttagatttttccaaa
ctcgaagccggtaagctggctttggagaatattccgtttgaattccaagaagtattggaa
gaggtggttaatctgcaagccaccagcgcgcatgaaaaagggttagaaatcaccctcaag
attgacccgaaaattccgcgcggcgtggtgggcgatccgctacggattcagcaagtcttg
accaacttggtcggtaactccattaagtttaccgagcgtggcaatatagacgtgagcgtg
gaaatgcgtgcgctacgcgatgatgtgatcgacctgcaatttatggtgcgcgacaccgga
attggcatttctgagcgccagcaagctcagttattccaagcctttagccaagcggatgcc
agtatttcacgccgttatggcggtacaggacttgggttggtgattacccaaaaactggtc
agccatatgggcggagaaatcagcctcaccagccgtttgcaccaaggttcaaccttctgg
ttcacgctgcgcctgcataccacagagctgcctctcaatgacggttataacgcggactcg
ctcaatcatcgccacttgctgctgattgaacccaatatgcaagccgctgcgattgtgcag
caaacgctggtccaaagtggtttagaagtgacgtaccgctctgcgattccggaagagcaa
cacgtttacgactatgtactgctcaacttagcgcctagtaaagagaccaatccgaccttg
gtggagctttgggtgcaacgcgcgttagccatgacccacaatgtgattgtcggtgtgccg
agcacagaactggcgctcgccgaccaattgatgcagcgctacccagtaaaatgcatcagt
aagcctttatctcgcaaaaaactgctacaaaccttggcagcgcaacagccgcaactcgcc
aataccagtttgcccaaacctcaagccgataagcttccgctgtgcgtcatggcggtcgat
gataatccagccaacctcaaactcatcactgcgctattgcaagagcgggttgagtacgtg
gtctcttgcaccagcggtcaggaggcgattgagcaagctcagagccgtcagttcgatatc
atcttgatggacattcaaatgccgcacatggatggagtgaccgcttgtaaagcgatcaag
cagctcaaagggtatcgtgatacgccagtcattgcggtcaccgcacatgccatggcaggc
gagcgtgaccgtctactgaaagcggggatggatgattacctgaccaaaccgattgaagag
catattctgcaacaagtgttggtacattggagcccgcacacgcgcagtaaacaggtcgcg
aaagtgaccccacccgatggtgctgcggtcatatctaacgccttaccctcatcaccgcca
gcagaagaggccattattgattggcctgtcgcgctgcgccaatccgccaataaagaggat
ctcgccaaagagatgctcgggatgttggtcgattatttgcgggaagtcgaaactgtggtc
aatactgcgcttgaggatgaagaataccccgctagcgatctgctgcatcatatccataag
ttgcatggcagttgttcgtacagcggcgtaccgcgcctgcgaaaaatctgcgccagtttg
gagcaagcgctgcgcaatggggcgagcatcgatgagttagagcctgagttatttgagttg
caagatgagatggcgaaagtgctcgaagcctctcgcgactatctgaactga

DBGET integrated database retrieval system