KEGG   Vibrio cholerae O1 O395: VC395_0726Help
Entry
VC395_0726        CDS       T02099                                 

Gene name
rluD
Definition
(GenBank) ribosomal large subunit pseudouridine synthase D
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
vcr  Vibrio cholerae O1 O395
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:vcr03009]
    VC395_0726 (rluD)
Enzymes [BR:vcr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     VC395_0726 (rluD)
Ribosome biogenesis [BR:vcr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    VC395_0726 (rluD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2 TruB_N
Motif
Other DBs
NCBI-ProteinID: ACP08744
Position
I:780046..781020
Genome map
AA seq 324 aa AA seqDB search
MAHQIELTQTVKDSQLGQRLDQAVAELFTDFSRSRLKEWLLEGKIAVNGDVITKPRTKVM
GGEVITVQAELEDEQRWEAQDLPLNIVYEDDDIIVINKPRDFVVHPGAGQADKTVLNALL
FHYPPIAEVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVRALQKRDVTREYEAIVIGTMT
AGGMIDKPIGRHSTKRTLMSVSPMGKHAVTHYRVAEHFREHTRLRLRLETGRTHQIRVHM
AYLQHPLLGDTAYGGRARIPKGATEELTEMIRDFDRQALHAVMLKFEHPVTGEELEFHAP
VPDDMVEMTLALREDAKLNRTEEY
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggctcatcagattgaattaactcaaacagtaaaagatagccagcttggtcaacgtctt
gatcaagctgtggctgaattatttaccgacttttcccgctcacgtttaaaagagtggttg
ttggaaggcaagattgccgtgaatggtgatgtcatcaccaaaccgcgtaccaaagtgatg
ggtggcgaggtgattaccgttcaggcagaactggaagacgaacagcgctgggaagcgcag
gatttgccactgaacattgtgtatgaagatgacgacattatcgttattaacaaaccgcgt
gactttgtggttcaccccggtgctggtcaggcggataaaaccgtgcttaacgcattgctg
ttccattatccgccgattgctgaagtgccacgtgcaggcatcgtccatcgtctcgataaa
gatacaacgggtttgatggtggtcgcgaaaacggttcccgcgcaaacacgcttggtacgt
gcactacaaaagcgcgacgtgactcgtgagtacgaagcgattgtgattggcacaatgacc
gcgggtggcatgattgataagccgattggccgtcactcgaccaaacgtactttaatgtcg
gtctctccgatgggcaaacatgccgtgacccattaccgtgtggcagagcatttccgtgaa
catacgcgtttgcgtctacgtttggaaacgggtcgtacccaccaaattcgtgtgcacatg
gcttatctgcaacacccactcttgggtgatacggcttatggtggtcgtgcacgcattccg
aaaggtgcgacggaagagctgacggaaatgattcgtgacttcgatcgccaagcactgcac
gcggtgatgttgaaatttgagcatccggttacgggggaagagctcgaattccatgcacca
gtgcctgatgatatggttgagatgacgcttgcactgcgtgaagatgcgaagctaaaccgc
actgaagagtattaa

DBGET integrated database retrieval system