KEGG   Vibrio cholerae O1 O395: VC395_0904Help
Entry
VC395_0904        CDS       T02099                                 

Definition
(GenBank) pseudouridine synthase Rlu family protein
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
vcr  Vibrio cholerae O1 O395
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:vcr03016]
    VC395_0904
Enzymes [BR:vcr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     VC395_0904
Transfer RNA biogenesis [BR:vcr03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    VC395_0904
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: ACP08918
Position
I:968850..969584
Genome map
AA seq 244 aa AA seqDB search
MLEIVYQDEYLVAVNKPAGMLVHRSWLDKHETEFVMQTLRDQIGQHVFPLHRLDRPTSGV
LVFALSSQIASEVMPMFANHEMEKTYHAIVRGWIEEANVLDYPLKEELDKIADKFAKQDK
EAQSAVTAYRPLAKVELPIATGKFATTRYCLMEMQPKTGRKHQLRRHMAHLRHPIVGDTT
HGDGVHNRLFREHFSAQRLMLHASELRFMHPYTQQPLVIRAGLDEVWQGLLSEFGWQESL
LINA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgctcgagattgtttatcaagatgaatatttggtggcggtcaataaaccggctggcatg
ttggtgcaccgttcatggctcgacaagcatgaaaccgagtttgtgatgcagaccctgcgc
gatcaaattggtcagcacgttttcccgctacaccgtctggatcgcccgacatccggtgtg
ttggtgtttgcgctttcgagtcagattgcctctgaagtgatgccgatgtttgccaatcat
gagatggagaaaacctaccacgccattgtgcgcggctggattgaagaggcaaatgtgctc
gattatccactcaaagaagagctcgacaaaattgccgataaatttgccaagcaagataaa
gaagcgcagtcggcggtgacagcttatcggccactcgccaaagtggaactgcccattgct
acgggaaagtttgccactacccgctattgcttgatggagatgcaaccgaagaccgggcgc
aaacatcagctgcgtcgtcatatggcacatctgcgtcatccgatagtgggtgataccacc
catggcgatggagttcataaccgactgtttcgtgaacacttttccgcgcaacgtttgatg
ctgcatgccagcgagttacgttttatgcatccttatacccagcagccgttagtgattcgc
gctggactagatgaagtgtggcaaggcttgcttagtgagtttggttggcaagagtcgctg
ttaatcaacgcttga

DBGET integrated database retrieval system