KEGG   Vibrio cholerae O1 O395: VC395_1535
Entry
VC395_1535        CDS       T02099                                 

Gene name
vgrG-1
Definition
(GenBank) vgrG protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
vcr  Vibrio cholerae O1 O395
Pathway
vcr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:vcr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    VC395_1535 (vgrG-1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:vcr02044]
    VC395_1535 (vgrG-1)
Secretion system [BR:vcr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   VC395_1535 (vgrG-1)
SSDB
Motif
Pfam: ACD Phage_GPD Phage_base_V DUF2345 Phage_Mu_Gp45 Cupin_3
Other DBs
NCBI-ProteinID: ACP09541
UniProt: A0A0H3AIG7
Structure
PDB: 

Position
I:1600166..1603453
AA seq 1095 aa
MATLAYSIEVEGLEDETLVVRGFHGQESLSNSVFLGQACYGFRYEVQLASRVSNLTAEQM
VDKRAELKLYRNSQLVQRVHGIVRAFSQGDIGHHHTFYQLTLVPALERLSLRHNSRIFQK
QTVPEILSILLQEMGINDYAFALKRDGVQREFCVQYRESDIDFLHRLAAEEGLVYSFVHE
AGKHTLYFSDASDSLSKLPEPIPYNALVGGAIDTPYIHGLTYRTQAEVSEVQLKDYSFKK
PAYSFLQTVQGTELDYQQTRYQHFDAPGRYKDDVNGAAFSQIRLDYLRRHAHTATGQSNE
PLLRAGYKFDLQEHLDPAMNRDWVVVSINHQGEQPQALQEDGGSGATTYSNQFSLIPGHL
HWRAEPQPKPQVDGPMIATVVGPEGEEIFCDEHGRVKIHFPWDRYSNGNEQSSCWVRVSQ
GWAGSQYGFIAIPRIGHEVIVEFLNGDPDQPIITGRTYHATNTPPYTLPEHKTKTVLRTE
THQGEGFNELSFEDQAGKEQIYLHAQKDFDGLIENDQFTQIKHNQHLTVEWESREAVTGE
QVLSIEGSLHVKTGKVRVNEAGTEIHVKAGQKVVIEAGSEITVKAGGSFVKVDPAGVHLS
GALVNLNSGGSAGSGSGFGGAMPALPGGLEPAVALAPPQTISYQALLQAEQANVPAVKVC
PLAAQEATPAVNSITPPPPPPIAPPMAPPQPIMNPQPTANAQPNLGRSTKATPDFPTHFP
KSSIGIENELAGLVVAMPANSAQKFGYVKSAQGDALFMLTKDMNQGSYQRPPSLQDGKNY
QNWQTHTVELVSYPCEMDDKAAVETRKQAMLWLATHFTTHIDQSNHQPLAPIQSEDGRFV
IEITNAKHVIAAGNGISAESQGQTITMTPSGQQATVGVAAKGFGTSATPELRLLESAPWY
QKSLKSQFASLTSAENLDDKELAANVFAYLTSIYLKTAELAKKFGIYINEWDPMSEQITP
NANGLTDPKVKNAWEILPRTKPSKIVEILSKSDAKAVMKHIKPQLQSRYSESLSKNVFQY
FQDGGEVAGHGINNATVGDKHSPELAILFEFRTVPNELQSYLPKTESTTKSEVKLLDQFD
PMKRKTVIQQVESLV
NT seq 3288 nt   +upstreamnt  +downstreamnt
atggcgacattagcgtacagcattgaggtggaagggctggaagatgagactctggtggtc
agaggcttccacgggcaggagtcactctctaatagtgtttttttagggcaagcctgttac
gggtttcgctacgaagtgcaactggcgagtcgggtatcaaacctcaccgccgagcagatg
gtggataagcgtgccgagctcaagctttaccgcaactcacagttggtgcagcgcgtgcac
ggcattgtgcgtgctttcagccaaggcgatatcggccatcaccacaccttctaccaactc
actttagtccctgccttagagcgcttatccctgcgtcataacagccgcattttccaaaag
cagactgtccctgagattctctctatcttgctgcaagagatgggcatcaacgattacgct
tttgcgctcaaacgtgatggcgtgcagcgtgagttttgtgtgcagtaccgcgaaagcgat
atcgactttctgcaccgcctcgccgctgaagaaggtttggtgtacagctttgtccatgaa
gcgggcaaacataccctctatttcagtgatgccagtgatagcctaagcaaactgccggag
cctatcccatacaacgctttagtcggtggcgcgatagataccccgtatatccacggctta
acctatcgcacccaagcagaagtgagcgaagttcagctcaaagactacagcttcaaaaag
ccagcctactcctttttgcaaaccgtgcagggtactgagctggattatcagcaaacgcgc
taccaacattttgatgcgccggggcgctacaaagacgatgtgaacggcgccgcctttagc
caaatccgtttagactacctgcgccgccatgcccataccgcaacagggcagagcaacgag
ccgctgctgcgtgccggctataagtttgacctgcaagagcaccttgaccccgcgatgaac
cgcgattgggtggtagtgtcgattaaccaccaaggtgagcagccgcaagcgctacaagaa
gacggtggcagcggcgctactacttacagcaatcagttcagcttaattccggggcatctt
cactggcgcgccgagccacaacccaaaccgcaagtcgatggtccaatgattgccacggtc
gtcggtcctgaaggcgaagaaatcttctgtgatgaacatgggcgggtgaaaatccatttc
ccgtgggaccgttactcgaacggtaacgagcaaagctcctgttgggtacgggtgtcgcaa
ggttgggcgggcagtcagtatggctttatcgctattccgcgcatcggccatgaagtgatt
gtagagtttttaaacggtgacccagaccaaccgattatcactggccgcacttatcatgcg
accaacacgccgccatacaccttgcctgagcacaaaaccaaaaccgtgctgcgcaccgag
acgcaccaaggggagggctttaacgagctcagttttgaagaccaagcgggcaaagagcaa
atctacctgcatgcgcagaaagattttgatggtttgattgaaaacgaccaatttacccag
attaagcacaaccaacacctgacggtggagtgggaaagtcgagaagcggtaacgggcgag
caagtgctgagtattgaaggctcgctgcatgtgaaaacaggcaaagttcgggtcaatgaa
gcgggtacagagatccatgtaaaagcgggacagaaagtggtgattgaagcgggctccgag
attaccgttaaagcgggcggcagctttgtgaaagtcgatccggctggggtgcatctgtcc
ggtgctttggtcaatctcaactctggcggcagcgctggtagtggtagcggctttggcggt
gcaatgcccgccttaccgggcggcttagaacccgccgtggcactggctccaccgcaaacc
atctcttaccaagcgttgctacaggccgagcaagcgaatgttcctgcggtgaaggtgtgt
cctttagccgctcaagaagcaacgcctgcggtgaatagtatcacgccgcctccaccacca
ccgattgctccgccaatggccccaccacaaccaataatgaatccacagccaaccgctaac
gcgcagcctaatcttggaagatccactaaggcaacgccggattttccaacacatttcccg
aagtcatccattggcattgagaatgagttagctggtctagtggtggctatgccagccaac
tcggcacagaaatttggctacgtgaaaagtgcacaaggtgatgcgctgtttatgttaacg
aaagacatgaaccaaggttcgtatcagcggccaccttcattacaagatggaaaaaattat
cagaattggcagacgcatacagtagagttggtgagctacccttgtgaaatggacgataaa
gctgccgttgaaacacgcaaacaagccatgttgtggttagcaacccactttactacgcat
atcgaccagtccaatcatcaaccattagctcctattcaaagtgaagacggacgctttgtt
atcgaaatcactaatgcgaagcatgtgattgctgcgggcaatgggatttctgcagaatct
caaggtcaaacaatcacgatgacaccaagtggacaacaagccacagtgggtgttgctgct
aaaggtttcgggacgagtgcaacgccagaattaaggttacttgaatcggcaccttggtat
cagaaatcactcaagagccaatttgcatctctaacgagcgcagaaaacttggatgataaa
gagttagctgcaaacgtatttgcttatctgacgtctatttatttaaaaacagcagagcta
gcgaagaagtttggtatttacatcaatgaatgggaccccatgtcggagcaaattactcca
aatgcgaatggattaacggatccaaaagtaaaaaatgcatgggaaatattgccacgtaca
aaaccaagcaaaatagtagaaatactcagtaagagtgatgccaaagcggttatgaaacat
atcaagcctcaattgcagtctcgctattctgagagtttgtcgaaaaatgtatttcaatat
ttccaagatggtggtgaagtagccggacacggtattaataatgcgacggtcggtgataaa
catagtccggaattggcgattttgtttgagttcagaactgttccgaatgaactgcaaagt
tatttgcctaaaacagaatcgacaactaagtcagaagtgaagttactcgatcagtttgat
cctatgaagcgtaaaacagtaattcaacaagtagaatcgcttgtgtaa

DBGET integrated database retrieval system