KEGG   Vibrio cholerae O1 O395: VC395_1537
Entry
VC395_1537        CDS       T02099                                 

Definition
(GenBank) conserved hypothetical protein
Organism
vcr  Vibrio cholerae O1 O395
SSDB
Motif
Pfam: Lipase_3 CarboxypepD_reg SdrD_B
Other DBs
NCBI-ProteinID: ACP09543
Position
I:1604451..1606376
AA seq 641 aa
MDSFNYCVQCNPEENWLELEFRSENDEPIDGLLVTITNQSAPSNTYTQTTSSGKVLFGKI
AAGEWRASVSQASLLTEVEKYASRKEGQESPVKKRAAAELDAADKDTKQYRFTTIGDFWD
EAPKDEFLQKQHKGIDVNASAEKAGFRLSHNQTYVFEIKALRSYMPVIIDTDEFNLVNSY
TFALLSKLAYATNDFNRDDGKTIDNQGAISTVISQLKRKERPTYSGDLQAKWLLEEIPYS
KALSAQYYAEDDVGSEGYIIFNDELAIIGVRGTEPYFQSKKPPVDNTKFKIIKAASGMAA
VIADKIESATDSPGMKDLIITDLDAAQIAPEEFGGTYVHRGFYQYTMALLSLMEKDLGLH
KIKKFYCCGHSLGGAGALLISALIKDSYHPPVLRLYTYGMPRVGTRSFVERYQNILHYRH
VNNHDLVPQIPTVWMNTDVSEGFHVLDVFKSRVDLMRKMLTDDDDDNYQHHGHLSQLLTY
NSNNQVLLTPKQTQVTMLDLANLATNDSVAMVDGLSDASIVEHGMEQHIPNLFEQLTALS
DESLMVHYQRAISALEQEIATLQQSYLTVKQAWIESIGNGTPTMNIGRLMSEMHSINKLI
ENRNKIRGELRQIVSDPQRMPATKFLISQQTLPDEIKVQIR
NT seq 1926 nt   +upstreamnt  +downstreamnt
atggattcatttaattattgcgtgcagtgtaaccctgaggaaaactggttagagctagag
tttcggagtgaaaatgatgaaccgatagatggtttgctagttacgattacgaaccaaagt
gccccctctaacacatacacgcaaaccacaagttcgggtaaggtgttgtttggcaagatt
gcggctggggaatggcgtgcttctgtaagccaagcttctctgttaactgaagtcgaaaaa
tatgccagccgtaaagagggacaagagtcgccagtgaaaaaacgagctgcggcagaactt
gacgccgcagataaagatacgaagcagtaccgctttaccactattggtgatttctgggat
gaagcaccaaaagatgagtttttacaaaagcagcataaagggatagatgtcaatgcttct
gctgagaaagcagggtttagactcagtcataaccagacctatgtttttgaaatcaaagca
ctacgtagctatatgccagtgattattgataccgatgaatttaacttggtgaatagttat
acctttgcgttgttgtcgaaattagcttatgcgactaacgattttaatagggatgatggt
aagacaatagataatcagggagcaattagcacggttatttctcaattgaagcgtaaagaa
agaccgacttattctggagatttacaagcaaagtggttattagaggaaattccatatagc
aaagcgttaagtgcccaatattatgctgaggatgatgtcggtagtgaaggttacatcatc
tttaacgatgaattggcgattataggtgtgagaggtacagagccttattttcagagtaag
aaaccacctgttgataacactaaatttaaaattataaaagcggcttcaggtatggcggct
gtgattgcggataagatagaaagtgctaccgattcaccaggaatgaaagaccttattata
acagaccttgatgctgcgcaaatcgcccccgaagagtttggtggaacatatgttcatcgg
gggttttaccaatatacgatggctttgttatctttgatggagaaagatctagggctacat
aaaataaaaaaattctattgttgtggccatagcttagggggcgctggtgcattacttata
agtgcattgattaaagatagctatcatcctccagtattgcgtttatatacatatggaatg
ccacgagtgggaactcgcagttttgtagagcgctatcaaaatattttgcattaccgtcat
gttaataatcacgatttggtgccacagataccaacagtatggatgaacacagatgtatct
gaaggattccatgtacttgatgtatttaaaagccgtgttgatctgatgagaaaaatgctc
actgatgatgatgatgacaattatcaacaccatggtcatttgtctcagttactaacttat
aattcaaataaccaagtcttactgacacccaaacaaactcaagtcactatgctagaccta
gcaaatttagccactaatgattctgttgctatggtagatggtttatcagatgcctcaata
gtagagcatggaatggagcagcatatacccaatttatttgagcagttaacagcactaagt
gatgaaagtttaatggtgcattatcaacgagcgatttcagccttagagcaggaaattgct
acgttgcaacaaagttatcttacagttaaacaagcttggattgaatctataggaaatggc
acgccgactatgaatatcggacgtttgatgagtgaaatgcattctataaataaattaata
gagaaccgtaataaaattagaggtgagctaaggcagatagtctctgatcctcagcgtatg
cctgcaactaaatttttaatttcacagcaaaccttaccagatgaaatcaaggtgcaaata
agatga

DBGET integrated database retrieval system